Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
GSTO2 antibody
GSTO2 antibody was raised using the N terminal of GSTO2 corresponding to a region with amino acids VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV
SSB antibody
SSB antibody is a nanocomposite that consists of neutralizing monoclonal antibodies. It is used in the field of Life Sciences to detect and analyze various proteins in human serum, such as alpha-fetoprotein and albumin. The SSB antibody specifically targets and binds to these proteins, allowing for their identification and quantification. Additionally, this monoclonal antibody has been shown to have natriuretic properties by binding to atrial natriuretic peptide (ANP), a hormone involved in regulating blood pressure and fluid balance. The SSB antibody can be immobilized on an electrode for use in diagnostic assays or research experiments. It is a valuable tool for scientists and researchers working in the field of Antibodies, providing accurate and reliable results. Furthermore, the SSB antibody has also been activated against botulinum toxin, making it an important component in botulinum detection kits.BMPR2 antibody
The BMPR2 antibody is a pharmaceutical product that belongs to the class of antibodies. It specifically targets the bone morphogenetic protein receptor type 2 (BMPR2), which plays a crucial role in regulating various cellular processes, including angiogenesis and lymphangiogenesis. This antibody binds to BMPR2 and inhibits its activity, thereby modulating the signaling pathways involved in bone morphogenetic protein (BMP) signaling. By targeting BMPR2, this antibody has potential applications in the field of Life Sciences for research purposes and as a potential therapeutic agent for diseases associated with aberrant BMP signaling. With its specificity and ability to modulate BMP signaling, the BMPR2 antibody offers promising opportunities for further exploration in the field of pharmaceuticals.
USP14 antibody
The USP14 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications to target specific molecules of interest. This polyclonal antibody is designed to recognize and bind to the USP14 protein kinase, which plays a crucial role in various cellular processes.HSPH1 antibody
HSPH1 antibody was raised using the middle region of HSPH1 corresponding to a region with amino acids EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQSNRPD1 antibody
SNRPD1 antibody was raised using the N terminal of SNRPD1 corresponding to a region with amino acids NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILSNAP23 antibody
The SNAP23 antibody is a highly specialized polyclonal antibody that targets the necrosis factor-related apoptosis-inducing protein complex. It is commonly used in the field of Life Sciences to study endothelial growth and other related processes. This antibody can also be used as a monoclonal antibody to neutralize specific proteins or growth factors in human serum. Additionally, it has been shown to have a high affinity for steroid receptors and can be used in various nuclear studies. With its advanced technology and specificity, the SNAP23 antibody is an essential tool for researchers in the field of Life Sciences.SYT1 antibody
The SYT1 antibody is a monoclonal antibody that specifically targets the Synaptotagmin-1 (SYT1) antigen. It is widely used in Life Sciences research for various applications, including the detection and analysis of SYT1 expression in cells and tissues. This antibody has been shown to have high specificity and sensitivity, making it a valuable tool for studying the role of SYT1 in synaptic transmission, neurotransmitter release, and other cellular processes.
CSTF2T antibody
CSTF2T antibody was raised using the C terminal of CSTF2T corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVTCD34 antibody
The CD34 antibody is a growth factor that plays a crucial role in microvessel density. This antibody is buffered and colloidal, making it ideal for use in various applications within the Life Sciences field. It is classified as a monoclonal antibody, which means it specifically targets a biomolecule of interest. The CD34 antibody has neutralizing properties and can be used as an immunosuppressant in certain cases. Its effectiveness can be measured through techniques such as electrophoresis and immunoassays. Additionally, this monoclonal antibody has been shown to interact with calmodulin, further highlighting its versatility and potential applications.West Nile virus antibody
The West Nile virus antibody is a highly effective neutralizing agent that can be used for the detection and treatment of West Nile virus infections. It has been shown to bind to specific viral proteins, preventing the virus from entering host cells and replicating. This antibody is produced using advanced monoclonal antibody technology, ensuring high specificity and potency. In addition to its antiviral properties, this antibody has also been demonstrated to have other beneficial effects. It can activate various immune responses, such as chemokine production and fibrinogen activation, which are essential for controlling viral infections. Furthermore, it has been found to have potential therapeutic applications in the treatment of certain cancers, as it exhibits anti-mesothelin and alpha-fetoprotein activities. With its wide range of applications in both diagnostics and therapeutics, this West Nile virus antibody is an invaluable tool in the field of life sciences.CHST14 antibody
CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPCK1 antibody
PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEERHPN1 antibody
RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP
4EBP1 antibody
The 4EBP1 antibody is a polyclonal antibody that belongs to the class of drug antibodies. It is widely used in life sciences research as an inhibitor and neutralizing agent. This antibody specifically targets and binds to 4EBP1, a family of binding proteins involved in regulating protein synthesis. The 4EBP1 antibody can be used in various applications such as Western blotting, immunoprecipitation, and immunofluorescence. It is buffered and optimized for use in different experimental conditions. Whether you are studying interleukins, ranolazine, or other chimeric proteins, the 4EBP1 antibody is a valuable tool for detecting and analyzing activated proteins. With its high specificity and sensitivity, this monoclonal antibody ensures accurate and reliable results in your research experiments.CD90 antibody
The CD90 antibody is a monoclonal antibody that targets the sclerostin protein. It is used to neutralize the activity of sclerostin, which is a negative regulator of bone growth. By blocking sclerostin, the CD90 antibody promotes bone formation and can potentially be used in the treatment of conditions such as osteoporosis.PDZRN4 antibody
PDZRN4 antibody was raised using the N terminal of PDZRN4 corresponding to a region with amino acids SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKLABHD2 antibody
The ABHD2 antibody is a highly effective life sciences product that has the ability to neutralize the EGFR protein, thereby inhibiting cell proliferation. This antibody is widely used in the field of medicine and has shown promising results in various applications. It has been found to have an inhibitory effect on mesenchymal stem cells and androgen activity. The ABHD2 antibody is also known for its effectiveness in treating lymphocytic choriomeningitis and has been used in adeno-associated viral therapy. Additionally, it exhibits an antiangiogenic effect by targeting chemokine signaling pathways. With its high specificity and potency, this polyclonal antibody is a valuable tool for researchers in the life sciences field.CD20 antibody
The CD20 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the CD20 protein, which is expressed on the surface of certain cells, including B lymphocytes. This antibody has been extensively studied and has shown promising results in various applications.
