Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CLDN19 antibody
The CLDN19 antibody is a glycation-specific polyclonal antibody that targets fatty acids. It is designed to bind to specific interleukin-6 receptors and promote endocytic uptake of growth factors. This antibody can be used in various life science applications, including research and diagnostics. It exhibits high specificity and affinity for its target, making it an ideal tool for studying the role of interleukin-6 in cellular processes. Additionally, monoclonal antibodies derived from the CLDN19 antibody have been shown to have neutralizing effects on interferon activity and collagen synthesis. With its unique properties and wide range of applications, the CLDN19 antibody is a valuable asset in the field of Life Sciences.PTGS1 antibody
PTGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWE
H1FOO antibody
H1FOO antibody was raised using the middle region of H1FOO corresponding to a region with amino acids KAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSTNFRSF9 antibody
The TNFRSF9 antibody is an active agent in the field of Life Sciences and is widely used as a serum marker. It specifically targets mesothelin, a glycoprotein that is often overexpressed in certain types of cancer. This antibody has been shown to inhibit the activity of telomerase, an enzyme involved in cell division and immortalization. Additionally, it has been found to modulate the expression of interferon-stimulated genes and interfere with the function of glycogen synthase kinase. The TNFRSF9 antibody is commonly used in research laboratories for various applications, including immunohistochemistry, Western blotting, and flow cytometry. With its high-flux binding capacity and specificity, this polyclonal antibody offers a valuable tool for scientists studying cellular processes and developing new therapeutic strategies.CYB5R3 antibody
The CYB5R3 antibody is a polyclonal antibody that is activated to target specific proteins involved in various biological processes. It has been extensively used in life sciences research to study the effects of these proteins on different cell types. This antibody has shown promising results in neutralizing the activity of TNF-α, a pro-inflammatory cytokine, and TGF-β1, a growth factor involved in tissue repair and fibrosis. Additionally, it has been used as an immobilization agent for neurotrophic factors and nuclear proteins. The CYB5R3 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs. Its high specificity and affinity make it a valuable tool for studying protein-protein interactions and identifying potential therapeutic targets.DHX30 antibody
DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHAnti-HIV p24 antibody
The Anti-HIV p24 antibody is a powerful tool in the fight against HIV. This monoclonal antibody specifically targets the p24 protein, which is an essential component of the HIV virus. By binding to this protein, the antibody prevents the virus from replicating and spreading throughout the body. In addition to its antiviral properties, the Anti-HIV p24 antibody has been shown to have other beneficial effects. It has been found to inhibit epidermal growth factor signaling, which is involved in cell proliferation and survival. This can help prevent the spread of cancer cells and may have potential applications in cancer treatment. Furthermore, studies have shown that this antibody can enhance the effectiveness of other targeted therapies, such as trastuzumab for HER2-positive breast cancer. By combining these treatments, researchers have observed improved outcomes and increased patient survival rates. The Anti-HIV p24 antibody also has potential diagnostic applications. It can be used in laboratory tests to detect the presence of HIV infection by binding
RB1 antibody
The RB1 antibody is a highly specialized monoclonal antibody that targets glycan dimers. It specifically recognizes and binds to the glycopeptide region of these dimers, which plays a crucial role in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in neutralizing the activity of chemokines, including TNF-α.
MNT antibody
The MNT antibody is a growth factor that has applications in Life Sciences. It is a monoclonal antibody that specifically targets human serum proteins. The MNT antibody is designed to recognize and bind to specific antigen-antibody reactions, allowing for the detection and analysis of various human proteins. This antibody contains specific amino acid residues that enable it to bind to dopamine and copper concentrations, making it useful for studying these substances in biological samples. Additionally, the MNT antibody can be used in cytotoxic assays and immobilization techniques. Its high specificity and affinity make it an excellent tool for researchers working with antibodies and autoantibodies.Lp-PLA2 antibody
The Lp-PLA2 antibody is a protein that plays a crucial role in various biological processes related to Life Sciences. It has been shown to be involved in fas-mediated apoptosis, the regulation of interleukin-6 production, and the organization of actin filaments. Additionally, this antibody exhibits phosphatase activity and has been found to interact with collagen and fibrinogen.
Luteinizing Hormone beta antibody
Luteinizing hormone beta antibody was raised in mouse using human LH as the immunogen.
Trichomonas vaginalis antibody
Trichomonas vaginalis antibody was raised in mouse using Trichomonas vaginalis as the immunogen.C18ORF54 antibody
C18ORF54 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLNKLH antibody
The KLH antibody is a highly specialized protein that plays a crucial role in various biological processes. It is an essential component of the transferrin and DNA aptamer systems, which are responsible for transporting molecules and regulating gene expression, respectively. Additionally, the KLH antibody has been shown to interact with TGF-β1, a key signaling molecule involved in cell growth and differentiation.Clostridum difficile toxin B antibody
Clostridum difficile toxin B antibody was raised in mouse using Toxin B of Clostridium difficile as the immunogen.TULP2 antibody
The TULP2 antibody is a powerful tool used in biochemical research and diagnostics. Antibodies are proteins that recognize and bind to specific molecules, such as peptides or proteins. In the case of TULP2 antibody, it specifically targets and binds to TULP2 protein.
C9ORF75 antibody
C9ORF75 antibody was raised using the middle region of C9Orf75 corresponding to a region with amino acids PPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQAJunB antibody
The JunB antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and inhibits the activity of JunB, a protein involved in endothelial growth. This antibody can be used for various applications, including quantitation and detection of JunB levels in samples, as well as for diagnostic purposes.MKRN2 antibody
MKRN2 antibody was raised using the N terminal of MKRN2 corresponding to a region with amino acids STKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCNOTCH1 antibody
The NOTCH1 antibody is a monoclonal antibody that specifically targets the NOTCH1 protein. It is commonly used in various assays and research studies in the field of life sciences. This antibody has been extensively tested and validated for its specificity and sensitivity.
HINT1 antibody
HINT1 antibody was raised using the N terminal of HINT1 corresponding to a region with amino acids ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHZAP70 antibody
The ZAP70 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and inhibits the growth factor erythropoietin receptor (EpoR). By blocking this receptor, the ZAP70 antibody acts as an anti-VEGF (vascular endothelial growth factor) and antiangiogenic agent, preventing the formation of new blood vessels.THOC3 antibody
THOC3 antibody was raised using the middle region of THOC3 corresponding to a region with amino acids LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND
