Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CTNNB1 antibody
The CTNNB1 antibody is a highly potent monoclonal antibody that has shown promising results in the field of Life Sciences. It acts as an active agent by specifically targeting and binding to the CTNNB1 receptor, leading to cell lysis and inhibiting its signaling pathway. This antibody has been extensively studied for its ability to inhibit the growth of cancer cells and has shown potent antitumor activity in various preclinical models.KRT8 antibody
The KRT8 antibody is a monoclonal antibody that specifically targets Keratin 8 (KRT8), a protein found in epithelial tissues. This antibody has been extensively studied and has shown promising results in various fields of research, particularly in the life sciences.
LPL antibody
The LPL antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of lipoprotein lipase (LPL), an enzyme involved in lipid metabolism. This antibody has been extensively studied for its potential therapeutic applications in various fields, including life sciences and ophthalmic formulations.PODXL antibody
The PODXL antibody is a highly specialized monoclonal antibody that targets the glycoprotein known as podocalyxin-like protein (PODXL). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.CD11c antibody
The CD11c antibody is a monoclonal antibody that specifically targets the CD11c protein. This protein is involved in various biological processes, including immune response and cell adhesion. The CD11c antibody has been extensively studied for its potential applications in the field of Life Sciences.GFAP antibody
The GFAP antibody is a neutralizing monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). GFAP is an intermediate filament protein found in astrocytes, a type of glial cell in the central nervous system. This antibody has been extensively studied in Life Sciences and has shown promising results in various applications.SNRP70 antibody
SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRAPP antibody
The APP antibody is a highly reactive monoclonal antibody used in Life Sciences. It is specifically designed to detect and bind to the amyloid precursor protein (APP), a glycoprotein involved in the growth factor signaling pathway. This antibody is commonly used in research and diagnostic applications to study the role of APP in various cellular processes.
SQSTM1 antibody
The SQSTM1 antibody is a cytotoxic agent used in Life Sciences research. It is commonly used to study the function of annexin A2, an important protein involved in various cellular processes. This antibody can be utilized in experiments such as immunofluorescence and Western blotting to detect the presence of SQSTM1 protein. Additionally, it has applications in clinical diagnostics for detecting autoantibodies against insulin and alpha-fetoprotein. The SQSTM1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. With its high specificity and sensitivity, this antibody is a valuable tool for studying various biological phenomena related to insulin regulation and cell signaling pathways.Lp-PLA2 monoclonal antibody
Lp-PLA2 monoclonal antibody is a highly specialized antibody used in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Lp-PLA2, an enzyme involved in the inflammation process. By binding to Lp-PLA2, this antibody helps to inhibit its activity, reducing inflammation levels in the body.
ACY1 antibody
The ACY1 antibody is a highly specialized monoclonal antibody that has been developed for various applications. It has been shown to be effective in neutralizing the activity of mesenchymal stem cells, making it a valuable tool for research and therapeutic purposes. Additionally, this antibody has demonstrated its ability to target and bind to specific proteins such as anti-mesothelin, fibrinogen, influenza hemagglutinin, and alpha-fetoprotein. This makes it an essential component in diagnostic tests and assays targeting these proteins. The ACY1 antibody has also shown potential antiviral properties, making it a promising candidate for the development of antiviral therapies. Its high specificity and affinity make it an invaluable tool for researchers and clinicians alike in their efforts to understand and combat various diseases and conditions.MYL6 antibody
The MYL6 antibody is a highly specific monoclonal antibody that targets the human serum. It is commonly used in assays and as an inhibitor in various research studies. This antibody specifically binds to collagen and hyaluronic acid, making it an excellent tool for studying these molecules and their interactions. Additionally, the MYL6 antibody has been shown to have cytotoxic effects on adipose tissue, making it a potential candidate for therapeutic applications. It can also be used in the detection of autoantibodies and as a tool to study urokinase plasminogen activator (uPA) signaling pathways. Furthermore, the MYL6 antibody has shown promising results as an anti-ICOS antibody, which could be beneficial in treating conditions related to thrombocytopenia. With its versatility and specificity, the MYL6 antibody is an invaluable tool for researchers in various fields of study.CK1 alpha 1 antibody
CK1 alpha 1 antibody was raised using the C terminal of CSNK1A1 corresponding to a region with amino acids HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGFHIST2H2AC antibody
HIST2H2AC antibody was raised using the middle region of HIST2H2AC corresponding to a region with amino acids IPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK
OVOL1 antibody
The OVOL1 antibody is a highly activated polyclonal antibody that specifically targets the chemokine OVOL1. This antibody has been extensively studied for its role in oxidative damage and its potential therapeutic applications. It has been shown to interact with various proteins, including erythropoietin, actin filaments, collagen, cationic peptides, superoxide, ketanserin, monoclonal antibodies, endothelial growth factors, androgen receptors, dopamine receptors, and E-cadherin. The OVOL1 antibody offers a promising avenue for further research into the mechanisms of oxidative damage and its potential treatment options.Dynamin 1 antibody
Dynamin 1 antibody was raised using the middle region of DNM1 corresponding to a region with amino acids PPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPA
Cytokeratin 84 antibody
Cytokeratin 84 antibody was raised using the middle region of KRT84 corresponding to a region with amino acids ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAECIRBP antibody
CIRBP antibody was raised using the middle region of CIRBP corresponding to a region with amino acids GYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNRBP1 antibody
The RBP1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has antiviral properties and specifically targets the RBP1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of RBP1.
BHMT antibody
The BHMT antibody is a highly specialized antibody that has been activated to target specific inhibitors in the body. It is commonly used in Life Sciences research and is known for its ability to bind to actin, a protein involved in cell movement and structure. This monoclonal antibody is widely used in various applications such as immunofluorescence, Western blotting, and immunohistochemistry. It can be used alongside other antibodies like phalloidin to study the dynamics of actin filaments within cells. The BHMT antibody has also been used in the detection of autoantibodies and atypical hemolytic disorders. Its versatility and specificity make it an essential tool for researchers in various fields. Additionally, this antibody does not interfere with the activity of multidrug antibiotics, making it an ideal choice for studies involving drug interactions.EIF4ENIF1 antibody
EIF4ENIF1 antibody was raised using the N terminal of EIF4ENIF1 corresponding to a region with amino acids TEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGIMYL6 antibody
MYL6 antibody was raised using the middle region of MYL6 corresponding to a region with amino acids PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT
