Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
LMO1 antibody
LMO1 antibody was raised in mouse using recombinant Human Lim Domain Only 1 (Rhombotin 1)SSB antibody
The SSB antibody is a specific antibody that belongs to the class of monoclonal antibodies. It has neutralizing properties and can be used in various applications in the field of Life Sciences. This antibody is commonly used in research to study the function of SSB (single-stranded DNA-binding protein) and its role in various biological processes.LHX2 antibody
The LHX2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It acts as a neutralizing agent against a specific antigen, targeting low-density lipoprotein (LDL) receptors. This soluble antibody binds to LDL receptors and prevents the uptake of LDL particles into cells. By blocking this process, it helps researchers study the role of LDL receptors in various biological processes.IFRD1 antibody
IFRD1 antibody was raised using the middle region of IFRD1 corresponding to a region with amino acids LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF
Nestin antibody
The Nestin antibody is a powerful tool for researchers in the field of Life Sciences. This polyclonal antibody specifically targets and binds to Nestin, an intermediate filament protein that is commonly used as a marker for neural stem cells. The antibody has been extensively tested and validated for its specificity and sensitivity in various applications, including immunohistochemistry, western blotting, and flow cytometry.
Thrombomodulin antibody
Thrombomodulin antibody is a monoclonal antibody that specifically targets thrombomodulin, an extracellular protein involved in blood coagulation and inflammation. This antibody has cytotoxic effects on cells expressing alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. It has been shown to reduce microvessel density and inhibit the formation of actin filaments in vitro. Thrombomodulin antibody can be used in life sciences research to study the role of thrombomodulin in various biological processes and as a potential therapeutic agent for conditions involving abnormal blood clotting or inflammation.PRDM1 antibody
PRDM1 antibody was raised in Mouse using a purified recombinant fragment of human PRDM1 expressed in E. coli as the immunogen.Elk1 antibody
The Elk1 antibody is a biomolecule that specifically targets the Elk1 protein, making it an essential tool in life sciences research. This polyclonal antibody recognizes the glycoprotein Elk1, which plays a crucial role in various cellular processes. It is involved in gene transcription and acts as a transcription factor that regulates the expression of genes involved in cell proliferation, differentiation, and survival.
COL1A1 antibody
COL1A1 antibody is a monoclonal antibody that specifically targets the COL1A1 protein. It binds to the apical membrane of cells and can be used for various applications in life sciences research. This antibody has been extensively studied and validated for its specificity and sensitivity. It is commonly used in immunohistochemistry, immunofluorescence, and Western blotting experiments. The COL1A1 antibody can also be used in diagnostic assays to detect the presence of autoantibodies or as a therapeutic agent in pharmaceutical preparations. Additionally, this antibody has shown potential antiviral properties and can inhibit the growth factor signaling pathway, making it a versatile tool for researchers in various fields.
LPL antibody
The LPL antibody is a monoclonal antibody that targets lipoprotein lipase (LPL) and has various characteristics and applications. LPL plays a crucial role in lipid metabolism, specifically in the breakdown of triglycerides. This antibody can be used in research studies to investigate the functions and mechanisms of LPL, as well as its involvement in various physiological processes.RPS5 antibody
The RPS5 antibody is a glycan-based growth factor used in Life Sciences. It specifically targets erythropoietin, a glycopeptide that stimulates red blood cell production. This monoclonal antibody binds to the erythropoietin receptor, blocking its activity and inhibiting the effects of erythropoietin. In addition to erythropoietin, the RPS5 antibody can also bind to other growth factors such as interleukin-6 and epidermal growth factor. This versatile antibody is widely used in research and diagnostic applications in fields such as immunology, oncology, and cell biology. With its high specificity and affinity, the RPS5 antibody provides reliable results for various experimental techniques including colloidal gold labeling, Western blotting, immunohistochemistry, and flow cytometry. Its ability to detect glycosylation patterns makes it particularly useful for studying glycan-related processes in cells and tissues. Whether you're investigating helicobacter infections or collagenBRAF antibody
The BRAF antibody is a monoclonal antibody that specifically targets the BRAF protein. It has been extensively studied in various research areas, including cancer biology and neuroscience. This antibody has shown high specificity and affinity for the BRAF protein, making it an ideal tool for studying its functions and interactions.GOT2 antibody
GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQITRIM45 antibody
TRIM45 antibody was raised using the N terminal of TRIM45 corresponding to a region with amino acids FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRSGRK2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been confirmed using a patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.CD11a antibody (Azide Free)
CD11a antibody was raised in rat using murine CD11a (LFA-a1) as the immunogen.
AKT1S1 antibody
AKT1S1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEPDZD2 antibody
The PDZD2 antibody is a proteolytic antigen that has been developed to inhibit tumor cell growth. This antibody, which belongs to the class of antibodies known as chimeric antigens, has shown promising results in Life Sciences research. It is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their specific needs.Cytokeratin 20 antibody
Cytokeratin 20 antibody was raised using the middle region of KRT20 corresponding to a region with amino acids DDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAA
Transglutaminase 2 antibody
Transglutaminase 2 antibody is a highly specialized monoclonal antibody that targets the transglutaminase 2 protein. This protein plays a crucial role in various cellular processes, including apoptosis, cell adhesion, and signal transduction. The antibody specifically recognizes and binds to transglutaminase 2, inhibiting its enzymatic activity.
IGF2BP2 antibody
The IGF2BP2 antibody is a monoclonal antibody that targets insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2). This antibody is widely used in Life Sciences research to study the role of IGF2BP2 in various cellular processes.TdT antibody
The TdT antibody is a highly specialized product in the field of Life Sciences. It is commonly used for streptavidin immobilization, collagen microsphere bioassays, and electrode-based experiments. This monoclonal antibody is designed to specifically target and bind to terminal deoxynucleotidyl transferase (TdT), an enzyme involved in DNA synthesis and repair. The TdT antibody is widely used in research laboratories and biotech companies for various applications, including cell proliferation studies, DNA sequencing, and immunohistochemistry. Its high affinity and specificity make it an essential tool for scientists working with growth factors, acetyltransferases, hybridoma cells, or studying human serum samples. Additionally, the TdT antibody has shown promising results in intraocular research, making it a valuable asset for ophthalmology studies. Trust the reliability and accuracy of the TdT antibody to enhance your experiments and advance your scientific discoveries.GSTT1 antibody
The GSTT1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has cytotoxic properties and is particularly effective against botulinum and helicobacter infections. This antibody works by binding to specific targets, such as β-catenin or histidine, inhibiting their activity and preventing the growth and proliferation of these harmful bacteria. Additionally, the GSTT1 antibody has neutralizing effects on various growth factors, including brain natriuretic peptide and TNF-α, which are involved in inflammation and immune responses. With its colloidal properties, this antibody can easily be used in various experimental setups for detection and analysis purposes. Researchers rely on the GSTT1 antibody to study the intricate mechanisms of cellular processes and identify potential therapeutic targets for various diseases.DNA PKcs antibody
The DNA PKcs antibody is a highly specialized monoclonal antibody used in Life Sciences research. This antibody specifically targets and binds to DNA-dependent protein kinase catalytic subunit (DNA PKcs), an important enzyme involved in DNA repair and recombination processes. By inhibiting the activity of DNA PKcs, this antibody can be used to study the role of this enzyme in various cellular processes.
