Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PEG10 antibody
The PEG10 antibody is a monoclonal antibody that acts as an inhibitory factor. It specifically targets and binds to PEG10, a protein involved in various cellular processes. This antibody has been shown to have inhibitory effects on fibronectin, acidic insulin, antiphospholipid antibodies, autoantibodies, anti-ACTH antibodies, collagen antibodies, and glycosylation. Additionally, the PEG10 antibody has demonstrated cytotoxicity against cells expressing tyrosinase and insulin antibodies. With its highly specific binding properties and diverse range of inhibitory effects, the PEG10 antibody holds great potential for therapeutic applications in various diseases and conditions.
ESR1 antibody
ESR1 antibody was raised in Mouse using synthetic peptide corresponding to aa(SLQKYYITGEAEGFPATVc) of human ESR1, conjugated to KLH as the immunogen.GAP43 antibody
The GAP43 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been shown to specifically bind to GAP43, a protein involved in neuronal development and regeneration. This antibody can be used for various applications, such as immunohistochemistry, western blotting, and ELISA. Additionally, it has been found to have neutralizing properties against TGF-β1, a cytokine involved in cell growth and differentiation. The GAP43 antibody is an essential tool for researchers studying neuronal development and its role in various diseases and conditions.CENPH antibody
The CENPH antibody is a highly specialized and cytotoxic antibody that is used in the field of Life Sciences. It has been found to have a significant impact on various cellular processes, including the regulation of fatty acid metabolism and the activation of β-catenin signaling pathway. Additionally, this antibody has shown promising results in combination with histone deacetylase inhibitors for the treatment of certain types of cancer.EPHA6 antibody
The EPHA6 antibody is a highly sought-after product in the field of Life Sciences. It is a polypeptide expression that acts as a recombinant antigen, making it an essential tool for researchers and scientists in various fields. This antibody specifically targets the EPHA6 antigen, which plays a crucial role in cell signaling pathways.Mouse anti Human IgE
Human IgE antibody was raised in mouse using human myeloma IgE as the immunogen.Vimentin antibody (HRP)
Vimentin antibody (HRP) was raised in sheep using purified recombinant human vimentin produced in bacteria as the immunogen.EGFR antibody
EGFR antibody is a cytotoxic agent that targets the epidermal growth factor receptor (EGFR). It is a monoclonal antibody that specifically binds to EGFR and inhibits its activity. This antibody has been shown to effectively block the binding of epidermal growth factor to its receptor, preventing downstream signaling pathways involved in cell proliferation and survival. In addition, EGFR antibody has been found to inhibit angiogenesis by reducing microvessel density and suppressing endothelial growth factor-induced angiogenesis. This antibody can be used in various life science research applications, including immunohistochemistry and western blotting. It is supplied as a buffered solution containing glycine and histidine, ensuring stability and optimal performance.TIE2 antibody
The TIE2 antibody is a highly effective medicament that targets specific molecules in the human body. It acts as a cross-linking agent, binding to extracellular polysaccharides and activating the growth factor TIE2. This activation leads to various biological processes and signaling pathways involved in angiogenesis and vascular development. The TIE2 antibody is available as both polyclonal and monoclonal antibodies, providing researchers in the Life Sciences field with versatile options for their experiments. Its specificity and efficacy have been demonstrated through mass spectrometry analysis, ensuring accurate and reliable results. Whether you are conducting research or developing therapeutic interventions, the TIE2 antibody is an essential tool for understanding and manipulating cellular processes.GDAP2 antibody
GDAP2 antibody was raised using the N terminal of GDAP2 corresponding to a region with amino acids SSLYSCYRNVLQLAKEQSMSSVGFCVINSAKRGYPLEDATHIALRTVRRFEFHD2 antibody
EFHD2 antibody was raised using the N terminal of EFHD2 corresponding to a region with amino acids MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGHemoglobin antibody
The Hemoglobin antibody is a powerful tool used in various research and diagnostic applications. It specifically targets the virus surface antigen and amyloid plaque, making it an essential component in studying viral infections and neurodegenerative diseases.
CDC2 antibody
The CDC2 antibody is a highly specialized phosphatase that is buffered and activated for optimal performance. It has cytotoxic properties and has been shown to inhibit the production of tumor necrosis factor-alpha (TNF-α), an inflammatory cytokine. This antibody specifically binds to antigen molecules, making it an essential tool in various research applications. It is commonly used in the life sciences field, particularly in the study of chemokines and other related proteins. The CDC2 antibody is available as both polyclonal and monoclonal antibodies, providing flexibility for different experimental needs. With its low-molecular-weight and colloidal properties, this antibody exhibits high specificity and sensitivity in detecting target proteins. Additionally, it can be used in conjunction with other antibodies or techniques such as methionine aminopeptidase assays for comprehensive analysis.KCTD6 antibody
KCTD6 antibody was raised using the N terminal of KCTD6 corresponding to a region with amino acids LRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVVPS8 antibody
VPS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDDPTLAICNDSGGlucagon antibody
Glucagon antibody was raised using the N terminal of GCG corresponding to a region with amino acids LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKSUMO2 antibody
The SUMO2 antibody is a monoclonal antibody that specifically targets and neutralizes the activity of SUMO2, a small ubiquitin-like modifier protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.RPE antibody
RPE antibody was raised using the N terminal of RPE corresponding to a region with amino acids ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQCalnexin antibody
The Calnexin antibody is a highly specialized monoclonal antibody that plays a crucial role in Life Sciences research. It is commonly used for the detection and analysis of tyrosinase, collagen, and other proteins involved in various cellular processes. This cytotoxic antibody has been extensively studied and validated for its specificity and sensitivity.ACHE antibody
The ACHE antibody is a highly specialized antibody that targets acetylcholinesterase (ACHE), an enzyme involved in the breakdown of the neurotransmitter acetylcholine. This antibody has been extensively studied and proven to be effective in various research applications within the Life Sciences field.
