Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,709 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(738 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75327 products of "Primary Antibodies"
Phenobarbital antibody
Phenobarbital antibody was raised in mouse using phenobarbital-KLH as the immunogen.
Pig RBC antibody (Texas Red)
Pig RBC antibody (Texas Red) was raised in rabbit using porcine erythrocytes as the immunogen.KIF2C antibody
KIF2C antibody was raised in mouse using recombinant Human Kinesin Family Member 2C (Kif2C)Cyclin H antibody
The Cyclin H antibody is a highly specialized antibody used in Life Sciences research. It is designed to target and detect cyclin H, a protein involved in cell cycle regulation. This specific antibody is produced through advanced monoclonal antibody technology, ensuring high specificity and sensitivity in its detection.RAB39 antibody
RAB39 antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFTDRD3 antibody
The TDRD3 antibody is a polyclonal antibody that specifically targets TDRD3 protein. It can be used in various research applications, including immunohistochemistry, western blotting, and immunofluorescence. TDRD3 is involved in the regulation of gene expression and plays a crucial role in spermatogenesis and embryonic development. This antibody has been shown to have neutralizing activity against dopamine and other growth factors, making it a valuable tool for studying their functions. Additionally, it can be used to detect the presence of TDRD3 autoantibodies in patient samples, which may have implications in certain diseases such as cancer or neurological disorders. With its high specificity and sensitivity, the TDRD3 antibody is an essential tool for researchers in the life sciences field.IGF1 antibody
The IGF1 antibody is a glycosylated monoclonal antibody that is used in the field of Life Sciences. It is designed to specifically bind to and neutralize interferon gamma (IFN-gamma), a cytokine involved in immune response regulation. This antibody has been extensively studied and has shown high affinity and specificity for IFN-gamma. It has been used in various research applications, including immunohistochemistry, flow cytometry, and Western blotting. The IGF1 antibody is formulated with excipients to ensure stability and efficacy. Its low density and acidic nature allow for easy penetration into tissues and cells. Additionally, this antibody has been conjugated with various labels such as fluorescent dyes or enzymes for detection purposes. Overall, the IGF1 antibody is a valuable tool for researchers studying the role of IFN-gamma in different biological processes.CLECL1 antibody
CLECL1 antibody was raised using the middle region of CLECL1 corresponding to a region with amino acids FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK
Caspase 6 antibody
The Caspase 6 antibody is a monoclonal antibody that specifically targets caspase 6, an enzyme involved in programmed cell death. This antibody binds to the nuclear region of cells and inhibits the activity of caspase 6, preventing cell death. It can be used as a therapeutic agent for conditions where excessive cell death is occurring.
OLIG2 antibody
The OLIG2 antibody is a highly specific monoclonal antibody that targets the OLIG2 protein. OLIG2 is a transcription factor that plays a critical role in the development of the central nervous system. This antibody binds to the antigen binding domain of OLIG2 and can be used for various applications in life sciences research.
EPB41 antibody
EPB41 antibody was raised using the N terminal of EPB41 corresponding to a region with amino acids SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD
PSA antibody
PSA antibody is an ultrasensitive detection tool that can be used in various applications. It is designed to detect prostate-specific antigen (PSA) with high accuracy and specificity. The antibody is immobilized on a carbon electrode, which provides a high surface area for efficient binding of the target molecule. This allows for the detection of PSA at very low concentrations.
IL13R antibody
The IL13R antibody is a high-specificity antagonist antibody that is used in Life Sciences research. It is designed to target the interleukin 13 receptor (IL13R), which plays a crucial role in various biological processes. This polyclonal antibody is derived from plasma and has been extensively purified and buffered for optimal performance.BAK antibody
The BAK antibody is a monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and bind to the BAK protein, which plays a crucial role in the regulation of cell death (apoptosis). This antibody has been extensively validated for use in various immunoassays, including Western blotting, immunohistochemistry, and flow cytometry.ANGPTL4 antibody
The ANGPTL4 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to ANGPTL4, a protein that plays a crucial role in various biological processes. By binding to ANGPTL4, this antibody can modulate its activity and function.PSAT1 antibody
PSAT1 antibody was raised using the N terminal of PSAT1 corresponding to a region with amino acids ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY
Endothelin 1 antibody
The Endothelin 1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and has proven to be effective in various applications such as electrophoresis and colloidal techniques. This antibody specifically targets the epidermal growth factor, which is a crucial growth factor involved in many biological processes.
PABPC1 antibody
PABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQCA5A antibody
The CA5A antibody is a polyclonal antibody that specifically targets the acetyltransferase enzyme. This antibody is widely used in life sciences research to study various processes and diseases. It has been shown to be effective in detecting and quantifying the presence of CA5A in samples, making it a valuable tool for researchers working on projects related to cryptosporidium, adeno-associated virus, alpha-fetoprotein, steroid hormones, β-catenin signaling pathway, and cholinergic systems. The CA5A antibody is also commonly used to investigate the role of this enzyme in growth factor and chemokine signaling pathways. Its high specificity and sensitivity make it an ideal choice for experiments requiring accurate detection of the target molecule.RAB1A antibody
RAB1A antibody was raised using the middle region of RAB1A corresponding to a region with amino acids AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC
ITGB3 antibody
The ITGB3 antibody is a powerful tool used in the field of life sciences. It is an antigen that has been extensively studied using mass spectrometric methods. This antibody specifically targets and binds to the nuclear protein ITGB3, which plays a crucial role in various cellular processes.
