Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,709 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(738 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75327 products of "Primary Antibodies"
C22ORF25 antibody
C22ORF25 antibody was raised using the N terminal Of C22Orf25 corresponding to a region with amino acids MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGLCXCL9 antibody
The CXCL9 antibody is a monoclonal antibody that specifically targets and binds to the chemokine CXCL9. This antibody is derived from bovine γ-globulin and has an antigen binding domain that recognizes the CXCL9 protein. It has been extensively studied in Life Sciences research for its role in immune responses and inflammation.
DDC antibody
The DDC antibody is a powerful tool in the field of Life Sciences. It is an antibody that can be used for various applications, including research and diagnostic purposes. This antibody is highly specific and can recognize and bind to a target protein called DDC (dopa decarboxylase). DDC is an enzyme that plays a crucial role in the synthesis of important neurotransmitters like dopamine.
GRK5 antibody
The GRK5 antibody is a highly effective substance used in the field of Life Sciences. It targets the protein kinase GRK5, which plays a crucial role in various biological processes. This antibody is designed to specifically bind to GRK5 and inhibit its activity, making it an invaluable tool for researchers studying signal transduction pathways and cellular signaling.
Troponin I Type 1 antibody
Troponin I Type 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRRVRVSADAMLRALLGSKHKVSMDLRANLKSVKKEDTEKERPVEVGD
Ku80 antibody
The Ku80 antibody is a monoclonal antibody that exhibits cell cytotoxicity and is used in various research applications within the Life Sciences field. It specifically targets the Ku80 protein, which is involved in DNA repair and plays a crucial role in maintaining genomic stability. This antibody can be used to study the function of Ku80 in different cellular processes, such as DNA damage response and repair mechanisms.PAX6 antibody
The PAX6 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is designed to target and neutralize the PAX6 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and validated in Life Sciences research, making it a reliable tool for scientists and researchers. It can be used in experiments involving adipose tissue, nuclear signaling pathways, and other cellular processes where PAX6 is involved. The PAX6 antibody is also available as polyclonal antibodies for different applications, including the detection of chemokines, angptl3 inhibitors, and alpha-fetoprotein. With its high specificity and effectiveness, this antibody is an essential tool for studying PAX6-related mechanisms and exploring their potential therapeutic applications.
C17orf75 antibody
C17orf75 antibody was raised using the middle region of C17orf75 corresponding to a region with amino acids KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHEDMBT1 antibody
DMBT1 antibody was raised using the N terminal of DMBT1 corresponding to a region with amino acids SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWGWIPF2 antibody
WIPF2 antibody was raised using the middle region of WIPF2 corresponding to a region with amino acids AAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPPCDC42EP5 antibody
CDC42EP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRSPPPPAVPQSAAPSPTestosterone Antibody
The Testosterone Antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of testosterone, a key steroid hormone in the human body. This antibody is designed to specifically bind to testosterone molecules, neutralizing their effects and preventing them from interacting with their target receptors.
ANXA1 antibody
The ANXA1 antibody is a highly specialized antibody that targets the adipocyte-specific antigen, Annexin A1 (ANXA1). This monoclonal antibody is widely used in Life Sciences research to study the role of ANXA1 in various biological processes. It specifically recognizes and binds to ANXA1, allowing researchers to investigate its function and regulation.Annexin A5 antibody
Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVV
TAFI antibody
TAFI antibody was raised in sheep using human TAFI purified from plasma as the immunogen.
NOG antibody
The NOG antibody is a monoclonal antibody that specifically targets epidermal growth factor-like (EGF-like) growth factors. It belongs to the family of antibodies known as neutralizing antibodies, which are designed to inhibit the activity of specific proteins or molecules in the body. The NOG antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.14-3-3 ε antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit potent bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, demonstrating its high efficacy in combating tuberculosis. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.GPX7 antibody
The GPX7 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. It is specifically designed to target and neutralize GPX7, an enzyme that plays a crucial role in the regulation of oxidative stress. The antibody has been extensively tested and validated for its efficacy in laboratory experiments.
RAVER1 antibody
RAVER1 antibody was raised using the N terminal of RAVER1 corresponding to a region with amino acids VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFRTRUB2 antibody
TRUB2 antibody was raised using the N terminal of TRUB2 corresponding to a region with amino acids MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV
MEK1 antibody
The MEK1 antibody is a glycopeptide that targets the growth factor receptor, specifically designed for use in Life Sciences research. This polyclonal antibody has been extensively tested and validated for its high specificity and sensitivity in detecting MEK1 protein. It can be used in various applications such as Western blotting, immunohistochemistry, and immunofluorescence.
TRAPPC6B antibody
TRAPPC6B antibody was raised using the middle region of TRAPPC6B corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF
AF10 antibody
The AF10 antibody is a monoclonal antibody that exhibits serum albumin-binding properties. It is commonly used in the field of Life Sciences for various applications. This antibody specifically targets amyloid plaque and can be used for research related to Alzheimer's disease and other neurodegenerative disorders. In addition, the AF10 antibody has been shown to bind to nuclear proteins, antibodies, and growth factors, making it a versatile tool in various biological studies. Furthermore, this antibody has demonstrated efficacy in detecting glycosylation patterns in human serum and studying endothelial growth and necrosis factor-related apoptosis-inducing factors. With its wide range of applications, the AF10 antibody is an invaluable resource for researchers in the field of Life Sciences.CD4 antibody
CD4 antibody was raised in Mouse using a purified recombinant fragment of human CD4 expressed in E. coli as the immunogen.
