Primary Antibodies

<p>CD40LG antibody was raised in Rabbit using Human CD40LG as the immunogen</p>

<p>C21ORF7 antibody was raised using the C terminal Of C21Orf7 corresponding to a region with amino acids DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA</p>

<p>Rabbit Polyclonal beta Catenin antibody (Ser37)</p>

<p>Rabbit polyclonal GABBR2 antibody (Ser783) (R2-Subunit)</p>

<p>Synthetic human phosphopeptide (Ser516) region immunogen; rabbit polyclonal Artemis antibody (Ser516)</p>

Rabbit polyclonal OR10H1 antibody

<p>ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA</p>

Rabbit polyclonal CTDNEP1 antibody (HRP)

<p>IHOG antibody was raised in Mouse using a purified recombinant fragment of human IHOG expressed in E. coli as the immunogen.</p>

<p>CYB5R3 antibody was raised in rabbit using the C terminal of CYB5R3 as the immunogen</p>

<p>Rabbit polyclonal RPL5 antibody</p>

Rubella virus antibody (HRP) was raised in goat using Rubeola strain HPV77 as the immunogen.

<p>Rabbit polyclonal SFRS5 antibody</p>

<p>The GRF1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the cyclase-activating domain of GRF1, a protein involved in the regulation of cellular functions. This antibody has been extensively tested and shown to have high specificity and affinity for its target. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The GRF1 antibody is also capable of neutralizing the activity of interferon-gamma (IFN-gamma), making it a valuable tool for studying immune responses. With its wide range of applications and reliable performance, this antibody is an essential component of any research involving GRF1 or IFN-gamma signaling pathways.</p>

<p>Rabbit polyclonal HP1 alpha antibody (Ser92)</p>

<p>CXORF26 antibody was raised using the middle region of Cxorf26 corresponding to a region with amino acids IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTL</p>

<p>Histone H4 (mono methyl K20) Monoclonal Antibody</p>

<p>Affinity purified Rabbit polyclonal HICE1 antibody</p>

<p>AKR1A1 antibody was raised in Rabbit using Human AKR1A1 as the immunogen</p>

<p>Rabbit Polyclonal AMPKB1 antibody (Ser182)</p>

Prostein antibody was raised in rabbit using N terminal sequence ITYVPPLLLEVGVEE and C terminal sequence FATQVVFDKSDLAKYSA of the human prostein protein as the immunogen.

<p>Rabbit Polyclonal PAK1 antibody (Thr212)</p>

<p>CD25 antibody (Azide free) was raised in rat using alpha chain IL-2 receptor as the immunogen.</p>

<p>PPP6R1 antibody was raised using the N terminal of PPP6R1 corresponding to a region with amino acids MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ</p>

<p>Rabbit polyclonal GPI antibody (biotin)</p>

<p>The Tau antibody is a highly specialized antibody that targets the epidermal growth factor (EGF) receptor. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of research applications in the field of Life Sciences.</p>

Factor IX antibody (FITC) was raised in goat using human Factor IX purified from plasma as the immunogen.

<p>The Uromodulin antibody is a highly specialized biotinylated antibody that is used in various research applications in the field of Life Sciences. This antibody specifically targets and binds to uromodulin, a protein found in high concentrations in human hepatocytes. The Uromodulin antibody has been extensively characterized and validated for its specificity and sensitivity.</p>

<p>The p53 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is specifically designed to target the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation.</p>

<p>HCK antibody was raised in Mouse using a purified recombinant fragment of HCK expressed in E. coli as the immunogen.</p>

<p>The Lamin A antibody is a specific antibody that is used as a medicament in various applications. It has the ability to bind to activated Lamin A, which plays a crucial role in regulating gene expression and maintaining the structural integrity of the nucleus. This antibody can be used for research purposes, such as studying protein-protein interactions or investigating the localization and function of Lamin A in different cell types.</p>

<p>Rabbit polyclonal 14-3-3 theta tau antibody (Ser232)</p>

<p>Purified Rabbit polyclonal GLX1 antibody</p>

<p>Affinity purified Rabbit polyclonal MYO1B antibody</p>

CHMP5 antibody was raised in Rabbit using Human CHMP5 as the immunogen

The Vitronectin antibody is a monoclonal antibody that specifically targets the growth factor Vitronectin. It has been shown to inhibit the activation of endothelial growth factor and protease activity. This antibody binds to specific target molecules on the surface of cells, preventing their interaction with other proteins and inhibiting their function. In addition, it has cytotoxic effects on certain cancer cells and can induce apoptosis, or programmed cell death. The Vitronectin antibody has also been found to bind to alpha-fetoprotein and necrosis factor-related apoptosis-inducing ligand, further highlighting its potential therapeutic applications in cancer treatment.

<p>Purified Polyclonal MRPS34 antibody</p>

<p>Goat polyclonal AFP antibody (Fab'2)</p>

The hCG antibody is a monoclonal antibody that specifically targets the human chorionic gonadotropin (hCG) hormone. It is commonly used in Life Sciences research and diagnostic applications. The hCG hormone is produced during pregnancy and is responsible for maintaining the corpus luteum, which produces progesterone to support the developing fetus. This antibody can be used to detect hCG in various biological samples, such as human serum or urine, and can be applied in immunoassays or other analytical techniques.

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>FAM120C antibody was raised in rabbit using the N terminal of FAM120C as the immunogen</p>

<p>Rabbit polyclonal DGKD antibody</p>

The AATF antibody is a highly specialized antibody that targets the urokinase plasminogen activator (uPA). It is also known as anti-ICOS antibodies and has cytotoxic and proteolytic properties. This antibody is widely used in Life Sciences research, particularly in studies related to collagen metabolism and regulation.

<p>Affinity purified Rabbit polyclonal FMO3 antibody</p>

<p>The PAD4 antibody is a highly specialized medicament used in the field of Life Sciences. It is an acidic, EGF-like glycoprotein that plays a crucial role in various biological processes. This antibody is particularly known for its ability to neutralize and inhibit the activity of glial fibrillary acidic protein (GFAP), which is found predominantly in adipocytes.</p>

<p>POLR2H antibody was raised using the N terminal of POLR2H corresponding to a region with amino acids DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE</p>

<p>MMP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK</p>

<p>Rabbit polyclonal PGK1 antibody (HRP)</p>

<p>Rabbit polyclonal CAMK2 A/B antibody (Thr286)</p>

<p>Rabbit polyclonal PLEK antibody</p>