Primary Antibodies

<p>CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP</p>

<p>Rabbit polyclonal SPTA2 antibody</p>

<p>SDF4 antibody was raised using the C terminal of SDF4 corresponding to a region with amino acids KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA</p>

<p>Affinity purified Rabbit polyclonal CCDC68 antibody</p>

<p>Rabbit polyclonal ARRC antibody</p>

<p>ANXA5 antibody was raised in Rabbit using Human ANXA5 as the immunogen</p>

<p>CD8a antibody was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.</p>

<p>CD38 antibody (Azide free) was raised in rat using CD38 as the immunogen.</p>

The PNMT antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP) in human serum. It is a highly specific and sensitive tool for detecting AFP levels in various clinical settings. This antibody can be used in research, diagnostic, and therapeutic applications related to AFP, such as cancer detection and monitoring. Additionally, the PNMT antibody has been shown to have neutralizing effects on certain factors involved in adipose tissue function, such as transferrin, adiponectin, and TGF-beta. This makes it a valuable tool for studying adipocyte biology and potential therapeutic interventions for conditions related to adipose tissue dysfunction. Furthermore, the PNMT antibody has been found to interact with adp-ribosyl cyclase and collagen, suggesting its potential role in modulating cellular processes involving these molecules.

<p>ABCF2 antibody was raised in mouse using recombinant Human Atp-Binding Cassette, Sub-Family F (Gcn20), Member 2 (Abcf2), Nuclear Gene Encoding Mitochondrial Protein</p>

<p>Mouse monoclonal DNAAF1 antibody</p>

<p>The GFAP antibody is a highly specific monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). This protein is predominantly expressed in astrocytes, and it plays a crucial role in maintaining the structure and function of these cells. The GFAP antibody can be used for various applications in life sciences research, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal PON2 antibody</p>

The CDK2 antibody is a high-specificity neutralizing antibody that targets a glycoprotein involved in cell cycle regulation. It has been shown to have low density and high specific activity, making it an ideal tool for research in the field of Life Sciences. This monoclonal antibody inhibits the activity of CDK2, a key enzyme involved in cell division and proliferation. By binding to CDK2, the antibody prevents its interaction with other proteins and interferes with the normal progression of the cell cycle. In addition to its role in cell cycle regulation, this antibody has also been found to have inhibitory effects on fatty acid metabolism and can modulate the production of superoxide and interferon. With its high specificity and potent neutralizing activity, the CDK2 antibody is an essential tool for researchers studying various biological processes and developing potential therapeutic interventions.

<p>VWF antibody (HRP) was raised in goat using human vWF purified from plasma as the immunogen.</p>

The SIGLEC9 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and binds to SIGLEC9, a transmembrane protein involved in various cellular processes. This antibody has been extensively studied for its potential therapeutic applications. One of the key characteristics of the SIGLEC9 antibody is its ability to modulate immune responses. It has been shown to activate immune cells, such as natural killer (NK) cells and macrophages, leading to enhanced anti-tumor activity. Additionally, this antibody can induce interferon-stimulated gene expression, which plays a crucial role in antiviral defense mechanisms. Moreover, the SIGLEC9 antibody has shown promise as a diagnostic tool. It can be used as a serum marker for certain diseases and conditions, including autoimmune disorders and cancer. By detecting the presence or absence of SIGLEC9 autoantibodies in patient samples, healthcare professionals can gain valuable insights into disease progression and treatment response. Furthermore,

<p>Purified Polyclonal Adenylate Cyclase 5/6 antibody</p>

<p>BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW</p>

<p>DCT antibody was raised in Rabbit using Human DCT as the immunogen</p>

<p>Purified Rabbit polyclonal MCSF Receptor antibody</p>

<p>Rabbit polyclonal EKI2 antibody</p>

<p>Rabbit polyclonal RPS18 antibody</p>

MLH1 antibody was raised in Rabbit using Human MLH1 as the immunogen

<p>The TMEFF2 antibody is a highly specialized drug antibody used in Life Sciences research. It is a polyclonal antibody that specifically targets TMEFF2, a protein involved in various cellular processes. This antibody can be used for immunohistochemistry and Western blotting experiments to study the expression and localization of TMEFF2 in different tissues and cell types.</p>

Influenza A antibody was raised in mouse using Influenza A as the immunogen.

Anti-Canine CRP antibody

<p>Affinity purified Rabbit polyclonal Axin 1 antibody</p>

<p>The SQS antibody is a highly specialized product in the field of Life Sciences. It is an essential component used in various applications such as hybridization, growth factor studies, and detection of specific proteins. This monoclonal antibody is specifically designed to target SQS (squalene synthase), an enzyme involved in cholesterol biosynthesis.</p>

<p>DHRS9 antibody was raised in Rabbit using Human DHRS9 as the immunogen</p>

<p>Rabbit polyclonal NQO2 antibody</p>

Mouse anti-human Cystatin-C protein monoclonal antibody

<p>Rabbit Polyclonal CREB antibody (Ser133)</p>

Armenian Hamster monoclonal FceRI alpha antibody

<p>CD4 antibody (FITC) was raised in mouse using chicken CD4 as the immunogen</p>

The ALDH1L1 antibody is a multidrug, tyrosine-neutralizing monoclonal antibody. It is specifically designed to target and bind to ALDH1L1, a protein complex involved in various biological processes. This antibody can be used in Life Sciences research as a tool to study the function and regulation of ALDH1L1.

<p>The MMP15 antibody is a highly specific antibody that targets matrix metalloproteinase 15 (MMP15). This antibody is designed to detect and bind to MMP15, which plays a crucial role in tissue remodeling and cell migration. It has been extensively tested for its specificity and sensitivity in various applications, including immunohistochemistry, western blotting, and ELISA.</p>

<p>Affinity purified Rabbit polyclonal COX6B1 antibody</p>

<p>Purified Polyclonal PKAC beta antibody</p>

<p>The PGD antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the receptor of a growth factor called PGD (Prostaglandin D2). This recombinant virus-derived antibody has been extensively tested on various carcinoma cell lines and human serum samples, demonstrating high specificity and affinity for the PGD receptor.</p>

<p>ANO2 antibody was raised in Rabbit using Human ANO2 as the immunogen</p>

<p>Purified Polyclonal RASSF8 antibody</p>

Mouse monoclonal HLA MHC Class I antibody

<p>DDX43 antibody was raised in Rabbit using Human DDX43 as the immunogen</p>

<p>CD25 antibody (Azide free) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell as the immunogen.</p>

<p>human NPY1R C-terminal peptide immunoge, Affinity purified Rabbit polyclonal NPY1R antibody, lyophilized</p>

<p>The KLF7 antibody is a highly specialized growth factor that targets specific acid residues within the nucleus. It has been extensively studied for its ability to regulate gene expression and cellular processes. The antibody has shown promising results in various research studies involving copper concentrations, immobilization techniques, and electrode applications.</p>

Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.

<p>The CtBP2 antibody is a highly specialized antibody that targets the anti-ICOS antibodies. It specifically binds to serum albumin protein and agonist proteins, effectively neutralizing their activity. This antibody has been extensively tested in various laboratory settings, including liver microsomes and drug antibody assays. It has shown potent chemokine-neutralizing properties, making it an essential tool for researchers in the life sciences field. The CtBP2 antibody is available in both polyclonal and monoclonal forms, providing flexibility for different experimental setups. Its activation potential and ability to target autoantibodies and growth factors make it a valuable asset in research studies.</p>

MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV

<p>Affinity purified Rabbit polyclonal RAMP1 antibody</p>