Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,624 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75324 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
TIM antibody
The TIM antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It specifically targets and binds to the epidermal growth factor, which plays a crucial role in cell proliferation and differentiation. The TIM antibody can be used in research related to heparin-induced thrombocytopenia, where it helps in identifying and studying the mechanisms involved in this condition.ACOT11 antibody
<p>ACOT11 antibody was raised in mouse using recombinant human ACOT11 (19-250aa) purified from E. coli as the immunogen.</p>Heparan Sulphate Proteoglycan antibody
The Heparan Sulphate Proteoglycan antibody is a highly specialized antibody used in Life Sciences research. It specifically targets and binds to heparan sulphate proteoglycans, which are complex molecules composed of sugar chains and proteins. These proteoglycans play important roles in various biological processes, including cell adhesion, growth factor signaling, and extracellular matrix organization.PRR11 antibody
<p>PRR11 antibody was raised using the middle region of PRR11 corresponding to a region with amino acids PGKSQMDLRKLLRKVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKF</p>Haemoglobin antibody
<p>The Haemoglobin antibody is a monoclonal antibody that specifically targets human serum. It is widely used in research and diagnostic applications, particularly in the field of mass spectrometry. This monoclonal antibody has been developed using advanced techniques and exhibits high specificity and affinity for its target. It can be used in various immunoassays, such as ELISA and Western blotting, to detect and quantify haemoglobin levels accurately. Additionally, this antibody has shown potential therapeutic applications, including neutralizing the effects of certain glycoproteins and proteolytic enzymes. Its unique properties make it a valuable tool for studying haemoglobin-related disorders and developing targeted treatments.</p>SFRS7 antibody
<p>SFRS7 antibody was raised using the middle region of SFRS7 corresponding to a region with amino acids SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP</p>TAF7L antibody
<p>TAF7L antibody was raised using a synthetic peptide corresponding to a region with amino acids QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ</p>Desmoglein 1 antibody
<p>Desmoglein 1 antibody was raised in mouse using recombinant human polypeptide Desmoglein 1 as the immunogen.</p>KCTD10 antibody
<p>KCTD10 antibody was raised using the middle region of KCTD10 corresponding to a region with amino acids EETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERIERVRRI</p>RAC1 antibody
<p>The RAC1 antibody is a monoclonal antibody that specifically targets the RAC1 protein complex. This antibody has a high affinity for RAC1 and can neutralize its activity. It is formulated with excipients such as globulin to ensure stability and effectiveness. The RAC1 antibody belongs to the family of Polyclonal Antibodies, which are widely used in Life Sciences research. It can be used as an antigen in various applications, including Western blotting, immunohistochemistry, and flow cytometry. This antibody is particularly useful for studying the role of RAC1 in cell growth, as well as its interaction with other proteins such as growth factors and mineralocorticoid receptors. Additionally, it has been shown to have low cross-reactivity with other proteins or lipoproteins. Researchers and scientists can rely on the high quality and specificity of this RAC1 antibody for their experiments and studies.</p>DGKA antibody
<p>The DGKA antibody is a highly specific monoclonal antibody that targets the octanoyltransferase enzyme. It is widely used in various assays and research studies in the field of life sciences. This antibody plays a crucial role in identifying and analyzing the function of DGKA, which is involved in several important cellular processes.</p>Hamster RBC antibody (FITC)
<p>Hamster RBC antibody (FITC) was raised in rabbit using hamster erythrocytes as the immunogen.</p>SOX17 antibody
The SOX17 antibody is a highly specialized monoclonal antibody that targets the HER2 protein. It works by binding to β-catenin, a protein involved in cell signaling pathways, and inhibiting its function. This antibody has been extensively tested and has shown excellent results in low-density lipoprotein (LDL) receptor-deficient mice. Additionally, it has been found to have synergistic effects when used in combination with other therapeutic agents such as interferon, caffeine, transferrin, and trastuzumab.
