Primary Antibodies

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>The DGKA antibody is a highly specific monoclonal antibody that targets the octanoyltransferase enzyme. It is widely used in various assays and research studies in the field of life sciences. This antibody plays a crucial role in identifying and analyzing the function of DGKA, which is involved in several important cellular processes.</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>DYRK1B antibody was raised in Rabbit using Human DYRK1B as the immunogen</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.</p>

<p>Rabbit polyclonal GDI2 antibody (biotin)</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>ELOF1 antibody was raised in rabbit using the middle region of ELOF1 as the immunogen</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>The Caspase 1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets caspase 1, an enzyme involved in various cellular processes such as apoptosis and inflammation. This antibody specifically recognizes and binds to caspase 1, allowing for its detection and analysis.</p>

<p>Mouse monoclonal HLAE antibody (PE)</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>Goat anti Human IgE antibody</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>