Primary Antibodies

<p>PCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI</p>

<p>TKTL1 antibody was raised using the middle region of TKTL1 corresponding to a region with amino acids QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA</p>

<p>The GILZ antibody is a growth factor that has been widely used as a diagnostic agent in various fields of research, including Life Sciences. It is a cationic antibody that exhibits strong biological effects and can be used as a fluorescent probe or photocatalytic agent. The GILZ antibody is typically conjugated with pluronic p123 to enhance its particle chemiluminescence properties. This monoclonal antibody specifically targets and binds to the antigen binding domain, allowing for accurate detection and analysis of specific molecules or proteins. With its activated state and high affinity for target antigens, the GILZ antibody provides researchers with a powerful tool for studying cellular processes and identifying potential therapeutic targets.</p>

<p>PREP antibody was raised using the N terminal of PREP corresponding to a region with amino acids THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF</p>

<p>ANKRD5 antibody was raised using the N terminal of ANKRD5 corresponding to a region with amino acids MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA</p>

<p>Rabbit polyclonal NFkB p65 antibody (Ser281)</p>

<p>Rabbit polyclonal MAD2L1BP antibody</p>

<p>AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE</p>

<p>AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSN</p>

Rabbit polyclonal FCGRT antibody

<p>Rabbit polyclonal CRYAB antibody (Ser19)</p>

<p>ASH2L antibody was raised in mouse using recombinant Human Ash2 (Absent, Small, Or Homeotic)-Like (Drosophila) (Ash2L)</p>

<p>Mouse monoclonal C3a desArg antibody</p>

<p>Rat monoclonal Entactin antibody</p>

<p>Protein kinase B, also known as Akt or RAC-alpha serine/threonine-protein kinase, is a serum- and glucocorticoid-regulated kinase with three closely related isoforms: Akt1, Akt2, and Akt3. While Akt1 and Akt3 are primarily expressed in the brain, Akt2 is most abundant in skeletal muscle and embryonic brown fat. These isoforms are key regulators in various physiological functions, including cell growth, proliferation, survival, angiogenesis, and metabolism, and Akt is also recognized as a proto-oncogene due to its role in cancer-related processes.</p>

<p>Myoglobin antibody was raised in rabbit using human heart derived myoglobin as the immunogen.</p>

<p>Purified Polyclonal CYSLTR1 antibody</p>

<p>The TOP2B antibody is a highly specialized product in the field of Life Sciences. It is designed to neutralize the activity of TOP2B, an enzyme involved in DNA replication and repair. This antibody can be used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence. It has been shown to effectively inhibit the activity of TOP2B in nuclear extracts and interfere with its function. Additionally, this antibody has been found to enhance the effects of interferon and trastuzumab, an anti-HER2 antibody. Its unique properties make it a valuable tool for researchers studying epidermal growth factor signaling, androgen receptor function, and other growth factor pathways. The TOP2B antibody is available for purchase and comes with detailed instructions for use.</p>

<p>Mouse monoclonal CISD1 antibody</p>

<p>The FSHR antibody is a polyclonal antibody used in Life Sciences research. It is specifically designed to target the follicle-stimulating hormone receptor (FSHR). This antibody is widely used in various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS</p>

<p>WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML</p>

<p>Purified Polyclonal MKK1 antibody</p>

<p>AKAP10 antibody was raised in Rabbit using Human AKAP10 as the immunogen</p>

Rabbit polyclonal SLC43A1 antibody

<p>Rabbit polyclonal CLUS antibody</p>

<p>FAM156A antibody was raised using the N terminal of FAM156A corresponding to a region with amino acids DPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPG</p>

<p>The CDCP1 antibody is a highly specialized polyclonal antibody that targets the glycosylation of the CDCP1 protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to play a crucial role in insulin signaling, as well as in the pathogenesis of certain diseases such as cryptosporidium infection. The CDCP1 antibody can also be used as a neutralizing agent against TNF-α, a key pro-inflammatory cytokine involved in various inflammatory conditions. Additionally, this antibody has shown potential as a growth factor for certain cell types and may have implications in tissue regeneration. With its versatility and specificity, the CDCP1 antibody is an essential tool for researchers and scientists working in diverse areas of biology and medicine.</p>

<p>Rabbit polyclonal COX5A antibody (HRP)</p>

<p>Purified Polyclonal GPR38 antibody</p>

<p>NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids  LQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA</p>

<p>The FGF21 antibody is a cytotoxic monoclonal antibody that targets the surface glycoprotein and is used in immunoassays. It has been shown to have potential therapeutic applications in Life Sciences, particularly in the field of gluconeogenesis regulation. The FGF21 antibody can be used as a treatment option in combination with high-dose chemotherapy or multiagent chemotherapy, and it has also shown promise when combined with histone deacetylase inhibitors. Additionally, this antibody exhibits natriuretic and growth factor properties, making it a versatile tool in various research and clinical settings.</p>

<p>Rat monoclonal B7H1 antibody (PE)</p>

<p>Purified Polyclonal RAB35 antibody</p>

<p>ELL2 antibody was raised in Rabbit using Human ELL2 as the immunogen</p>

<p>C1ORF43 antibody was raised using the middle region of C1Orf43 corresponding to a region with amino acids YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQ</p>

<p>COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ</p>

<p>Rabbit Polyclonal S6 antibody (Ser235)</p>

<p>Mouse monoclonal ING2 antibody</p>

<p>Rabbit polyclonal ZNF622 antibody</p>

<p>Rabbit polyclonal USP38 antibody</p>

<p>The MIA antibody is a polyclonal antibody that specifically targets annexin A2. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. The MIA antibody has shown high affinity and specificity towards its target, making it a valuable tool in studying the role of annexin A2 in different biological processes.</p>

<p>ARF1 Monoclonal Antibody (FITC)</p>

<p>The PEX5 antibody is a monoclonal antibody that has been specifically designed to target and neutralize the activity of PEX5, a protein involved in various cellular processes. This antibody is activated and reactive, making it highly effective in inhibiting the function of PEX5.</p>

<p>Rabbit polyclonal TOR1A antibody</p>

<p>Rabbit polyclonal FUCA2 antibody (FITC)</p>

<p>CDC5L antibody was raised in mouse using recombinant Human Cdc5 Cell Division Cycle 5-Like (S. Pombe) (Cdc5L)</p>

<p>Rabbit polyclonal HMG17 antibody</p>

<p>The 14-3-3 theta antibody is an essential tool in Life Sciences research. It is a high-quality antibody that specifically targets the 14-3-3 theta protein. This protein plays a crucial role in various cellular processes, including signal transduction, cell cycle regulation, and apoptosis.</p>

<p>LYSMD1 antibody was raised using the N terminal of LYSMD1 corresponding to a region with amino acids VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI</p>