Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,394 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75081 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
LOXL2 antibody
<p>The LOXL2 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to LOXL2, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and quantifying LOXL2 levels in different samples.</p>Caldesmon antibody
<p>Caldesmon antibody is a highly specific monoclonal antibody that targets caldesmon, a protein involved in smooth muscle contraction. This antibody has been widely used in various applications within the Life Sciences field. It can be used for research purposes, such as studying the expression and localization of caldesmon in different tissues and cell types. Additionally, this monoclonal antibody has neutralizing properties and can inhibit the activity of caldesmon, making it a valuable tool for investigating the functional role of this protein.</p>p53 antibody
<p>The p53 antibody is an essential tool for researchers in the field of life sciences. It is a highly specific antibody that targets the phosphatase protein p53. This protein plays a crucial role in regulating cell growth and preventing tumor formation. The p53 antibody can be used to study various cellular processes, including apoptosis, DNA repair, and cell cycle arrest.</p>PPCDC antibody
<p>PPCDC antibody was raised using the N terminal of PPCDC corresponding to a region with amino acids VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV</p>CAPNS1 antibody
<p>The CAPNS1 antibody is a monoclonal antibody that serves as an affinity ligand for adeno-associated viruses. It is specifically designed to target and bind to solubilized and isolated retinal proteins. This antibody is widely used in various life sciences research applications, such as intermediate assays and the development of new medicaments. It has demonstrated high specificity for interleukin proteins and has been proven effective in detecting autoantibodies in nuclear medicine. The CAPNS1 antibody is a valuable tool for researchers in the field of Life Sciences seeking reliable and accurate results in their experiments.</p>MAP3K10 antibody
<p>MAP3K10 antibody was raised in rabbit using the C terminal of MAP3K10 as the immunogen</p>CHRFAM7A antibody
<p>CHRFAM7A antibody was raised in Rabbit using Human CHRFAM7A as the immunogen</p>FBXW11 antibody
<p>FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD</p>ROPN1L antibody
<p>ROPN1L antibody was raised in rabbit using the N terminal of ROPN1L as the immunogen</p>CPEB4 antibody
<p>CPEB4 antibody was raised using the N terminal of CPEB4 corresponding to a region with amino acids DEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQGD</p>SF3B14 antibody
<p>SF3B14 antibody was raised using the middle region of SF3B14 corresponding to a region with amino acids HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK</p>AATF antibody
<p>The AATF antibody is a monoclonal antibody that targets the AATF protein. It has been shown to be effective in inhibiting the growth of cancer cells, particularly in breast cancer (MCF-7) cells. The AATF antibody works by blocking the interaction between AATF and other proteins involved in cell proliferation and survival, such as adalimumab and interleukin-6. This inhibition leads to a decrease in tumor necrosis factor-alpha (TNF-α) production and ultimately hinders cancer cell growth.</p>MMP15 antibody
<p>The MMP15 antibody is a powerful tool used in Life Sciences research. It specifically targets and neutralizes the activity of matrix metalloproteinase 15 (MMP15), an enzyme involved in various biological processes such as tissue remodeling, wound healing, and cancer progression.</p>GLCCI1 antibody
<p>GLCCI1 antibody was raised using the middle region of GLCCI1 corresponding to a region with amino acids PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSAD</p>PRKRA antibody
<p>PRKRA antibody was raised in mouse using recombinant Human Protein Kinase, Interferon-Inducible Double Stranded Rna Dependent Activator</p>STMN1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. Through extensive research, it has been determined that this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication.</p>CDC25C antibody
<p>CDC25C antibody was raised in rabbit using the N terminal of CDC25C as the immunogen</p>SETD7 antibody
<p>The SETD7 antibody is a monoclonal antibody that specifically targets SETD7, an enzyme involved in various cellular processes. This antibody has been shown to react with levothyroxine and interleukin-6, indicating its potential role in modulating thyroid hormone levels and immune responses. Additionally, the SETD7 antibody has demonstrated reactivity towards basic proteins such as collagen, suggesting its involvement in extracellular matrix remodeling. Furthermore, this monoclonal antibody may have implications in cholinergic signaling due to its reactivity with acetylcholine and acetyltransferase. Overall, the SETD7 antibody shows promise as a versatile tool for studying protein function and exploring potential therapeutic applications.</p>TP53 antibody
<p>The TP53 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the TP53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The TP53 antibody binds to the collagen and actin filaments within cells, allowing for the detection and study of TP53 expression levels.</p>ATPB antibody
<p>ATPB antibody is a monoclonal antibody that specifically targets ATPB, a protein involved in cell energy production. This antibody has been shown to have toxic effects on ATPB, leading to the inhibition of its function. By blocking ATPB activity, this antibody disrupts the production of creatine kinase and TNF-α, both of which are essential for cellular processes. Additionally, the ATPB antibody binds to actin filaments, interfering with their structure and function. This antibody is widely used in Life Sciences research and is available as both polyclonal and monoclonal antibodies. It can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA). The ATPB antibody also shows promising potential as a therapeutic agent for targeting diseases related to abnormal ATPB function, including collagen-related disorders and certain types of cancer.</p>
