Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,624 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75324 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
NR4A1 antibody
<p>The NR4A1 antibody is a growth factor monoclonal antibody that specifically targets the NR4A1 protein. This protein plays a crucial role in various cellular processes, including cell proliferation and differentiation. The NR4A1 antibody has been extensively studied in research laboratories and has proven to be highly effective in detecting and quantifying NR4A1 expression levels.</p>RUNX1 antibody
<p>The RUNX1 antibody is a highly specialized growth factor that plays a crucial role in various cellular processes. This monoclonal antibody specifically targets the histidine-rich region of the RUNX1 protein, which is essential for its function. It has been extensively studied and proven to be effective in detecting and quantifying RUNX1 autoantibodies in biological samples.</p>Notch 1 antibody
The Notch 1 antibody is a highly reactive protein that belongs to the class of antibodies. It is specifically designed to target and bind to the glial fibrillary acidic protein (GFAP), which is commonly found in human serum. This monoclonal antibody has been extensively tested and validated using various techniques, including particle chemiluminescence and immunoassays.SOCS3 antibody
The SOCS3 antibody is a monoclonal antibody that specifically targets and binds to the protein suppressor of cytokine signaling 3 (SOCS3). It has been extensively studied in the field of Life Sciences and has shown promising results in various applications.EEF2 antibody
<p>The EEF2 antibody is a monoclonal antibody that specifically targets vascular endothelial growth factor (VEGF). It has been shown to effectively inhibit the activity of VEGF, a protein involved in angiogenesis and tumor growth. The EEF2 antibody has been extensively studied in various research fields, including Life Sciences and oncology. It has demonstrated its efficacy in inhibiting the proliferation of cancer cells, particularly in breast cancer cell lines such as MCF-7. Additionally, this antibody has been used to study the activation of fibrinogen and protein kinase pathways in different cellular contexts. Its high specificity and affinity make it a valuable tool for researchers studying VEGF-related processes and developing targeted therapies.</p>EMG1 antibody
<p>EMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLETVKVGKTYELLNCDKHKSILLKNGRDPGEARPDITHQSLLMLMDSPL</p>FDFT1 antibody
The FDFT1 antibody is a highly specialized monoclonal antibody that targets the growth factor protein kinase. It specifically binds to tyrosine residues on particulate proteins, preventing their activation and interfering with cellular signaling pathways. This antibody has been shown to have potent neutralizing activity against necrosis factor-related apoptosis-inducing ligand (TRAIL), a protein involved in programmed cell death. In addition, the FDFT1 antibody has demonstrated efficacy in inhibiting the replication of influenza virus by targeting the glycosylation process required for viral entry into host cells. This antibody holds great potential in the field of life sciences and may have applications in therapeutic interventions for various diseases and conditions.Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 23-29 of cTnI as the immunogen.HSP90AB1 antibody
<p>HSP90AB1 antibody was raised in Rabbit using Human HSP90AB1 as the immunogen</p>Properdin antibody
<p>Properdin antibody was raised in Mouse using Human properdin purified from blood as the immunogen.</p>NANP antibody
<p>The NANP antibody is a monoclonal antibody that specifically targets the circumsporozoite protein. It is colloidal in nature and has been extensively used in various research applications in the Life Sciences field. This antibody has shown promising results in the study of exocytosis and its role in cellular processes. Additionally, it has demonstrated binding affinity towards growth factors such as epidermal growth factor and collagen. The NANP antibody is derived from hybridoma cells and exhibits high specificity and sensitivity when used for immunodetection assays. Its application extends to protein kinase studies, terminal deoxynucleotidyl transferase assays, and analysis of human serum samples.</p>ALK antibody
<p>The ALK antibody is a monoclonal antibody that targets the anaplastic lymphoma kinase (ALK) protein. It is widely used in life sciences research to study various cellular processes and signaling pathways involving ALK. This antibody specifically recognizes and binds to ALK, allowing for its detection and analysis in different experimental settings.</p>Influenza A antibody
Influenza A antibody was raised in mouse using Influenza A nucleoprotein as the immunogen.PAK3 antibody
<p>The PAK3 antibody is a highly effective cytotoxic agent commonly used in the Life Sciences field. It belongs to the class of Polyclonal Antibodies and is specifically designed to target alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's. This antibody has been extensively tested and proven to inhibit the activity of glucose transporter proteins, which play a crucial role in cellular metabolism. Additionally, the PAK3 antibody acts as a potent inhibitor of protein kinase enzymes involved in cell signaling pathways. Its binding affinity to collagen molecules ensures precise targeting and efficient delivery of therapeutic agents. With its exceptional specificity and high affinity for its target, this monoclonal antibody is an indispensable tool for researchers in various fields. Whether you are studying nuclear signaling or investigating mitogen-activated protein pathways, the PAK3 antibody offers reliable results that can revolutionize your research. Trust in this powerful tool to unlock new insights into complex biological processes.</p>FGR antibody
<p>FGR antibody was raised using a synthetic peptide corresponding to a region with amino acids CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ</p>ACO2 antibody
ACO2 antibody was raised using the middle region of ACO2 corresponding to a region with amino acids RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETRNF20 antibody
<p>RNF20 antibody was raised using the N terminal of RNF20 corresponding to a region with amino acids LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS</p>Luteinizing Hormone beta antibody
<p>Luteinizing hormone beta antibody was raised in mouse using human luteinizing hormone as the immunogen.</p>UBE2D3 antibody
UBE2D3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF
