Primary Antibodies

<p>SLA2 antibody was raised in rabbit using the middle region of SLA2 as the immunogen</p>

<p>IGFBP3 antibody was raised in Rabbit using Human IGFBP3 as the immunogen</p>

<p>PHLDA3 antibody was raised using the N terminal of PHLDA3 corresponding to a region with amino acids LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC</p>

<p>Mouse monoclonal GNA2132 antibody</p>

<p>Rabbit polyclonal 14-3-3 alpha/beta antibody (HRP)</p>

<p>GSTM1 antibody was raised in Rabbit using Human GSTM1 as the immunogen</p>

<p>Phospho-Phospholamban antibody was raised in rabbit using a synthetic peptide conjugated to KLH, corresponding to amino acids 14-25 of human cardiac phospholamban (RA[pS]TIEMPQQAR-C) as the immunogen.</p>

<p>Mouse monoclonal CD28 antibody (biotin); target human</p>

<p>Purified Polyclonal Histone Deacetylase 6 antibody</p>

<p>Rabbit polyclonal CYP7B1 antibody</p>

<p>PNKP antibody was raised using the middle region of PNKP corresponding to a region with amino acids ALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTT</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>The TFAM antibody is a powerful tool used in Life Sciences research. It is specifically designed to target and bind to the mitochondrial transcription factor A (TFAM), a protein involved in regulating mitochondrial DNA replication and transcription. This antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>Rabbit polyclonal RPS13 antibody (HRP)</p>

<p>Rabbit polyclonal OsTLP9 antibody</p>

KLC2 antibody was raised in Rabbit using Human KLC2 as the immunogen

<p>Rabbit Polyclonal USP8 antibody</p>

<p>HSV2 gE antibody was raised in mouse using HSV 2, gE as the immunogen.</p>

<p>MCM10 antibody was raised in Rabbit using Human MCM10 as the immunogen</p>

<p>PGM3 antibody was raised using the middle region of PGM3 corresponding to a region with amino acids GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN</p>

<p>HADHB antibody was raised using a synthetic peptide corresponding to a region with amino acids LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE</p>

<p>The ARNT2 antibody is a highly specialized antibody that is used in various assays and research studies in the field of Life Sciences. This antibody specifically targets and binds to ARNT2, which is a protein involved in various cellular processes. The ARNT2 antibody can be used for applications such as immunohistochemistry, western blotting, and ELISA.</p>

<p>SOHLH1 antibody was raised using the middle region of SOHLH1 corresponding to a region with amino acids EAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLT</p>

<p>Mouse monoclonal PGR antibody (Ser190)</p>

<p>CDC2L6 antibody was raised in Rabbit using Human CDC2L6 as the immunogen</p>

<p>The HSP90 alpha antibody is a cytotoxic agent that targets the heat shock protein 90 (HSP90) alpha isoform. This antibody specifically binds to HSP90 alpha, inhibiting its function and preventing the proper folding and stabilization of client proteins. HSP90 is involved in various cellular processes, including the folding and maturation of proteins such as erythropoietin and fibronectin. By blocking HSP90 alpha, this antibody disrupts these processes, leading to cellular dysfunction and ultimately cell death.</p>

<p>MITD1 antibody was raised using the middle region of MITD1 corresponding to a region with amino acids RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWI</p>

<p>Mouse monoclonal GBA3 antibody</p>

<p>Mouse monoclonal NDEL1 antibody</p>

<p>Rabbit Polyclonal Elk1 antibody (Ser389)</p>

<p>Rabbit Polyclonal Tsc2 antibody (Ser939)</p>

<p>Cdk1 Mouse Monoclonal Antibody (FITC)</p>

<p>The ASNS antibody is a monoclonal antibody that specifically targets the asparagine synthetase (ASNS) protein. This protein plays a crucial role in cellular growth and metabolism by catalyzing the conversion of aspartate to asparagine. The ASNS antibody can be used in various research applications, including immunoassays, Western blotting, and immunohistochemistry.</p>

<p>Rabbit polyclonal ENTPD1 antibody</p>

<p>The EMR2 antibody is a highly specific monoclonal antibody that targets the EMR2 antigen. This antigen plays a crucial role in various cellular processes, including interleukin-6 signaling, antibody-drug conjugate internalization, nuclear localization, glycosylation, phosphatase activity regulation, and exocytosis.</p>

Glycogen Synthase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, making it highly efficient in treating tuberculosis infections. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>The BRAF antibody is a highly potent monoclonal antibody that belongs to the group of chemokine antibodies. It exhibits strong cytotoxic and antitumor activity, making it an effective treatment for various types of cancer. This antibody specifically targets BRAF, a protein involved in cell growth and division, and neutralizes its function. By inhibiting BRAF, the antibody prevents the growth and spread of cancer cells.</p>

<p>Rabbit polyclonal EFNA2 antibody</p>

<p>The AXL antibody is a highly specific monoclonal antibody that targets the AXL receptor tyrosine kinase. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been validated for use in multiple species and has shown high specificity and sensitivity.</p>

<p>CNDP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC</p>

<p>The CPA1 antibody is a highly reactive monoclonal antibody that is used in antiestrogen therapy. It specifically targets and binds to the fatty acid CPA1, inhibiting its activity. This antibody has been shown to block the interaction between CPA1 and interleukin-6, a growth factor involved in cancer cell proliferation. Additionally, the CPA1 antibody acts as a potent inhibitor of protein kinase activity, specifically targeting the CDK4/6 pathway. This makes it an effective tool for studying cell cycle regulation and potential therapeutic applications. With its high specificity and affinity, the CPA1 antibody is a valuable asset in life sciences research.</p>

HNF4A antibody was raised using the middle region of HNF4A corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI

<p>Rabbit polyclonal RBMS1 antibody</p>

<p>Rabbit polyclonal PKC theta antibody (Thr538)</p>

<p>Purified Polyclonal ANT4 antibody</p>

<p>Purified Polyclonal TIN2 antibody</p>

<p>Rabbit polyclonal PSME3 antibody (FITC)</p>

<p>CKMB antibody was raised in mouse using purified human CK-MB as the immunogen.</p>

<p>The Myoglobin antibody is a highly specific and effective tool used in spectrometric and electrode-based assays. This Monoclonal Antibody has been developed to target the myoglobin protein, which plays a crucial role in oxygen storage and transport in muscle tissues. The Myoglobin antibody has been extensively tested and proven to have neutralizing properties against myoglobin, making it an ideal choice for research studies involving myoglobin-related processes.</p>