Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,764 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
RGS16 antibody
The RGS16 antibody is a highly specialized chemokine that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown promising results in different applications. This monoclonal antibody specifically targets alpha-fetoprotein, an important protein found in human serum. It has also demonstrated remarkable anti-mesothelin activity, making it a potential therapeutic option for mesothelioma treatment.ICK antibody
<p>The ICK antibody is a highly specialized antibody that targets the tyrosine kinase receptor, which plays a crucial role in growth factor signaling. This antibody is designed to specifically bind to the receptor and inhibit its activity, thereby blocking the downstream signaling pathways involved in cell growth and proliferation.</p>PPP2R3A antibody
<p>PPP2R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD</p>Dog RBC antibody (Texas Red)
Canine RBC antibody (Texas Red) was raised in rabbit using canine erythrocytes as the immunogen.TAMRA antibody
The TAMRA antibody is a cytotoxic monoclonal antibody that specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α). It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. The TAMRA antibody binds to TNF-α, preventing it from binding to its receptors and exerting its pro-inflammatory effects. This inhibition of TNF-α activity can help reduce inflammation and alleviate symptoms associated with various inflammatory conditions.Insulin Receptor α antibody
The Insulin Receptor alpha antibody is a monoclonal antibody that specifically targets the insulin receptor alpha subunit. It plays a crucial role in regulating glucose metabolism and is involved in various cellular processes such as growth, differentiation, and survival. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting insulin signaling pathways.26S Proteasome P52 Subunit antibody
26S Proteasome P52 Subunit antibody was raised in mouse using 26S proteasomes purified from Xenopus laevis ovary as the immunogen.FHIT antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth by preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.Hepatitis C Virus antibody
Hepatitis C virus antibody was raised in mouse using highly pure HCV NS5a as the immunogen.C1ORF184 antibody
<p>C1ORF184 antibody was raised using the C terminal Of C1Orf184 corresponding to a region with amino acids NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV</p>Cytokeratin 8 antibody
<p>Cytokeratin 8 antibody was raised using the N terminal of KRT8 corresponding to a region with amino acids MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL</p>ENPEP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through patch-clamp techniques on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.Tubulin Beta 3 antibody
<p>The Tubulin Beta 3 antibody is a highly specific monoclonal antibody that targets the Tubulin Beta 3 protein. It has been extensively studied and shown to have neutralizing properties against various isoforms of 14-3-3. This antibody is widely used in research and diagnostic applications to study the role of Tubulin Beta 3 in different cellular processes.</p>LIMK2 antibody
<p>The LIMK2 antibody is a highly specialized medicament used in Life Sciences research. It is a monoclonal antibody that specifically targets and inhibits the activity of LIM kinase 2 (LIMK2). LIMK2 plays a crucial role in various cellular processes, including cytoskeletal dynamics, cell migration, and cell adhesion.</p>SQSTM1 antibody
The SQSTM1 antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the SQSTM1 protein. This protein plays a crucial role in various cellular processes, including autophagy and cell signaling pathways.Hepatic Lipase antibody
<p>The Hepatic Lipase antibody is a powerful tool in Life Sciences research. This antibody specifically targets the necrosis factor-related apoptosis-inducing hormone peptide, which plays a crucial role in various cellular processes. It has been extensively used to study the function of catechol-o-methyltransferase and its interaction with other proteins.</p>TNKS antibody
<p>The TNKS antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and neutralizes the activity of tankyrase enzymes. Tankyrases play a crucial role in various cellular processes, including the regulation of Wnt signaling, telomere maintenance, and DNA repair.</p>TRPM4 antibody
<p>The TRPM4 antibody is a high-quality monoclonal antibody that specifically targets the TRPM4 protein. This antibody is widely used in life sciences research and has been shown to have excellent specificity and sensitivity. It binds to the carbonyl group of the TRPM4 protein, inhibiting its activity and preventing downstream signaling pathways.</p>CD2 antibody
<p>The CD2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It interacts with CD2, a cell surface glycoprotein expressed on T cells, natural killer cells, and thymocytes. This antibody has been extensively studied for its potential applications in various areas of research.</p>PUS10 antibody
<p>PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN</p>
