Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,757 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75327 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
FBXO24 antibody
<p>FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids LCATRECLYILSSHDIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMA</p>HGF antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>PTBP2 antibody
PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids AITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVADAMTS4 antibody
<p>ADAMTS4 antibody was raised using the N terminal of ADAMTS4 corresponding to a region with amino acids GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL</p>TRAF4 antibody
<p>TRAF4 antibody was raised in rabbit using the middle region of TRAF4 as the immunogen</p>C11ORF67 antibody
C11ORF67 antibody was raised using the middle region of C11Orf67 corresponding to a region with amino acids SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTHexokinase 3 antibody
<p>The Hexokinase 3 antibody is a highly specialized antibody that plays a crucial role in various biological processes. This antibody specifically targets and binds to the glycine microsphere, which is involved in the regulation of phosphatase activity and growth factor signaling.</p>RBPMS antibody
RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids RELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDFAH antibody
FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGCD28 antibody
<p>CD28 antibody was raised in hamster using CD28 costimulatory receptor as the immunogen.</p>Cyp8b1 antibody
The Cyp8b1 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets and detects the Cyp8b1 protein. This protein plays a crucial role in various cellular processes, including the metabolism of imatinib, activation of p38 MAPK pathway, and regulation of extracellular histones.SF4 antibody
SF4 antibody was raised using the middle region of SF4 corresponding to a region with amino acids TFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIKGRB2 antibody
The GRB2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and neutralize the activity of GRB2, a protein involved in cell signaling pathways. This antibody can be used to study various aspects of cell growth, differentiation, and development. It is commonly used in experiments involving chemokines, growth factors, and agonist proteins. The GRB2 antibody is also useful for detecting the presence of autoantibodies or drug antibodies in biological samples. Its high specificity and affinity make it an essential tool for researchers studying cellular processes and signaling pathways.LKB1 antibody
The LKB1 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α), a protein involved in inflammation and immune response. Additionally, this antibody has been shown to interact with calmodulin, an important regulatory protein involved in various cellular processes. The LKB1 antibody is also reactive against amyloid proteins, which are associated with neurodegenerative diseases such as Alzheimer's. Furthermore, it acts as a family kinase inhibitor and inhibits the activity of LKB1, a protein kinase that plays a crucial role in cell growth and metabolism regulation. This antibody may have potential applications in studying the inhibitory factors of interleukins and investigating the pathogenesis of infectious diseases caused by Brucella abortus.ERCC1 antibody
<p>The ERCC1 antibody is a highly specialized Monoclonal Antibody that has the ability to neutralize the activity of ERCC1, a protein involved in DNA repair. This antibody specifically targets and binds to ERCC1, preventing it from repairing damaged DNA. The ERCC1 antibody has shown promising results in laboratory studies, demonstrating its potential as a therapeutic agent for various diseases and conditions.</p>WDR66 antibody
WDR66 antibody was raised using the N terminal of WDR66 corresponding to a region with amino acids GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLVFAM78B antibody
FAM78B antibody was raised using the middle region of FAM78B corresponding to a region with amino acids PSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTTKEKIILQTIKWRMCampylobacter jejuni antibody
<p>Campylobacter jejuni antibody is a monoclonal antibody that specifically targets and binds to the antigen present in Campylobacter jejuni, a bacterium commonly associated with foodborne illnesses. This antibody has been widely used in Life Sciences research to study the pathogenesis of Campylobacter infections and develop diagnostic tests. It can also be used as an inhibitor to block the activity of certain proteins, such as c-myc or epidermal growth factor receptor, which are activated by Campylobacter infection. Additionally, this antibody has shown potential in detecting the presence of Campylobacter jejuni in various samples, including adipose tissue or alpha-fetoprotein. Its high specificity and affinity make it a valuable tool for researchers and professionals working in microbiology or infectious diseases.</p>Nexilin antibody
Nexilin antibody was raised using a synthetic peptide corresponding to a region with amino acids EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKIMouse anti Human IgE
Human IgE antibody was raised in mouse using purified human IgE as the immunogen.TPD52L1 antibody
TPD52L1 antibody was raised in mouse using recombinant human TPD52L1 (1-131aa) purified from E. Coli as the immunogen.Rubisco antibody
The Rubisco antibody is a polyclonal antibody that plays a crucial role in iron homeostasis. It binds to Rubisco, an enzyme involved in the fixation of carbon dioxide during photosynthesis. This antibody has been shown to have high affinity for Rubisco and can be used in various applications, including Western blotting and immunohistochemistry. Additionally, the Rubisco antibody has been found to have lipid binding properties, suggesting its potential involvement in lipid metabolism. Its iron binding capabilities make it a valuable tool for studying iron-related processes such as nitrogen metabolism and transferrin-mediated iron uptake. Moreover, this monoclonal antibody has shown neutralizing activity against influenza hemagglutinin, making it a promising candidate for the development of antiviral therapeutics.
