Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,709 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(738 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75327 products of "Primary Antibodies"
Tetraspanin 1 antibody
Tetraspanin 1 antibody was raised using the middle region of TSPAN1 corresponding to a region with amino acids TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAEPO antibody
EPO antibody was raised in Mouse using a purified recombinant fragment of human EPO expressed in E. coli as the immunogen.SH2 antibody
The SH2 antibody is a polyclonal antibody that has cytotoxic properties. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets and inhibits the activity of family kinases, making it an effective inhibitor for various cellular processes. Additionally, the SH2 antibody has been shown to have neutralizing effects on proteins such as VEGF (vascular endothelial growth factor) and circumsporozoite protein. It can also be utilized in studies involving mesenchymal stem cells and has shown promising results in inhibiting their growth. The SH2 antibody is a valuable tool for researchers looking to study specific cellular pathways and investigate potential therapeutic targets.
VRK3 antibody
The VRK3 antibody is a polyclonal antibody that is used in the field of intraocular research. It is specifically designed to detect and neutralize autoantibodies that may be present in the eye. This antibody acts as an inhibitor, preventing these autoantibodies from causing damage or inflammation. Additionally, the VRK3 antibody can also be used in combination with other antibodies, such as monoclonal antibodies, to enhance their effectiveness. This antibody has been shown to reduce viscosity and promote endothelial growth, making it an important tool in studying various growth factors and cytokines involved in eye health. Furthermore, the VRK3 antibody has been found to have a high affinity for interferon-gamma (IFN-gamma), a key immune system regulator. Overall, this versatile antibody plays a crucial role in understanding and developing treatments for ocular diseases and conditions.
PON1 antibody
The PON1 antibody is a highly specialized antibody used in the field of Life Sciences. It has been extensively studied for its cytotoxic properties and its ability to interfere with cellular processes. This antibody specifically targets sn-38, a potent DNA damaging agent, and neutralizes its effects. The PON1 antibody has also shown promising results in inhibiting the activity of tyrosinase, an enzyme involved in melanin production. This makes it a potential candidate for the development of anti-pigmentation treatments. Additionally, this monoclonal antibody can be used in various research applications, such as protein isoform analysis and detection using colloidal gold or enzyme-linked immunosorbent assays (ELISA). Its reactive nature makes it suitable for use on various platforms, including electrode-based biosensors. With its diverse applications and potential therapeutic uses, the PON1 antibody is a valuable tool in the field of biomedical research.Rhotekin antibody
Rhotekin antibody was raised using the middle region of RTKN corresponding to a region with amino acids IETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPPSerpinA3 antibody
The SerpinA3 antibody is a highly specialized antibody that has various characteristics and applications in the field of Life Sciences. This antibody plays a crucial role in regulating microvessel density, acting as an anticoagulant, and modulating the activity of growth factors. It specifically targets nuclear fatty acids and exhibits high specificity for SerpinA3.
Chondroitin 4 Sulfate antibody
Chondroitin-4 sulfate antibody was raised in mouse using mouse proteoglycan as the immunogen.SLAIN2 antibody
SLAIN2 antibody was raised using the N terminal of SLAIN2 corresponding to a region with amino acids LSAKSGGGPGSGPRRTSSEELRDATSLLAAGEGGLLDEVEPLRPDELERLMouse Lymphocyte antibody (FITC)
Mouse lymphocyte antibody (FITC) was raised in rabbit using RBC-free mouse thymus and spleen cells as the immunogen.SP1 antibody
The SP1 antibody is a monoclonal antibody that specifically targets tissue transglutaminase. It is used in Life Sciences research to study the role of this enzyme in various biological processes. The SP1 antibody has been shown to have neutralizing effects on chemokines, fibronectin, and collagen, making it a valuable tool for investigating their functions. Additionally, this antibody can be used to detect the presence of activated nuclear proteins and has been found to inhibit the activity of natriuretic peptides. With its high specificity and versatility, the SP1 antibody is an essential component in many scientific studies.Tyrosine Hydroxylase antibody
Tyrosine hydroxylase antibody was raised in mouse using mouse monoclonal as the immunogen.
CD3 antibody (FITC)
CD3 antibody (FITC) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.Desmin antibody
Desmin antibody is a protein that specifically targets desmin, a structural protein found in muscle cells. It is commonly used in research and diagnostic applications to detect the presence and distribution of desmin in various tissues. This antibody can be used for immunohistochemistry, immunofluorescence, and Western blotting techniques. Desmin antibody is available as both polyclonal antibodies, which are produced from multiple clones of B cells, and monoclonal antibodies, which are derived from a single clone of B cells. The use of desmin antibody can provide valuable insights into the structure and function of muscle cells and their involvement in various physiological processes.C21ORF13 antibody
C21ORF13 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII
PML antibody
The PML antibody is a highly specific monoclonal antibody that is used in various applications in the field of life sciences. It can be used for the detection and quantification of PML (promyelocytic leukemia) protein, a key player in cellular processes such as apoptosis and DNA repair. The antibody is produced by hybridoma cells and has been extensively characterized for its specificity and affinity towards PML. It can be immobilized on various surfaces, such as an electrode or amide-coated plates, for use in immunoassays. Additionally, the PML antibody can be used in conjunction with other antibodies, such as anti-CD33 antibody, for multiplexing experiments or to study protein-protein interactions. Its high sensitivity and low background make it an ideal tool for researchers working with human serum samples or studying the role of PML in disease development.SLC2A3 antibody
The SLC2A3 antibody is a highly specialized monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. This antibody specifically targets the SLC2A3 protein, which plays a crucial role in glucose transport across cell membranes.AGPAT2 antibody
AGPAT2 antibody was raised using the C terminal of AGPAT2 corresponding to a region with amino acids LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA
CSK antibody
The CSK antibody is a powerful inhibitor that belongs to the family of antibiotics. It is available in both polyclonal and monoclonal forms. This antibody specifically targets fibrinogen, a protein involved in blood clotting, and inhibits its activity. Additionally, the CSK antibody has been shown to bind to alpha-synuclein, a protein associated with Parkinson's disease, and prevent its aggregation. This antibody also acts as a dopamine receptor antagonist and can be used in research studies to investigate the role of dopamine in various physiological processes. Furthermore, the CSK antibody has been found to inhibit the activity of tyrosine kinases, which are enzymes involved in cell signaling pathways. This inhibition can have therapeutic implications for conditions such as cancer where abnormal tyrosine kinase activity is observed. The CSK antibody also binds to annexin proteins and modulates their function. Overall, this versatile antibody offers a wide range of applications in both basic research and clinical settings.ASK1 antibody
The ASK1 antibody is a monoclonal antibody that is used in various assays to detect the presence of ASK1 protein. ASK1, also known as apoptosis signal-regulating kinase 1, is a key regulator of cell growth and survival. This antibody specifically targets ASK1 and can be used in research studies to investigate its role in different cellular processes.
CXCR7 antibody
The CXCR7 antibody is a highly specialized antibody that targets the CXCR7 receptor, which is expressed in various cells including cardiomyocytes and alpha-fetoprotein-producing cells. This antibody can be used for research purposes to study the function of CXCR7 and its role in different biological processes.cRAF antibody
The cRAF antibody is a monoclonal antibody that specifically targets the cRAF protein isoforms. It is commonly used in research and diagnostic applications to detect and quantify the expression of cRAF protein. The antibody can be used in various techniques such as transcription-polymerase chain reaction (PCR), cytometry analysis, and electrochemical impedance spectroscopy. It has also been shown to have cytotoxic effects on cancer cells, making it a potential candidate for targeted therapy. Additionally, the cRAF antibody has been used in combination with other antibodies or drugs, such as decitabine or colony-stimulating factor, to enhance its therapeutic efficacy. With its high specificity and sensitivity, this antibody is a valuable tool for studying cRAF-related pathways and developing novel treatments for diseases associated with abnormal cRAF expression.EGFR antibody
The EGFR antibody is a highly effective growth factor that targets the c-myc protein. It is available in both polyclonal and monoclonal forms, offering versatility in its applications. This cytotoxic antibody has been extensively studied and proven to be effective in various assays, including the inhibition of human chorionic gonadotropin (hCG) and anti-VEGF assays. The EGFR antibody specifically targets nuclear glycoproteins, making it an ideal choice for research involving inhibitors and other nuclear-related studies. With its high specificity and potency, this monoclonal antibody is a valuable tool for researchers in the field of molecular biology and beyond.
CAD antibody
CAD antibody was raised using the N terminal of CAD corresponding to a region with amino acids AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV
RAN antibody
The RAN antibody is a powerful tool used in Life Sciences research. It is an alpha-fetoprotein antibody that specifically targets and binds to the RAN protein. This monoclonal antibody can be conjugated with various compounds, such as tyrosine or cytotoxic agents, to enhance its therapeutic potential. The RAN antibody has been extensively studied for its role in cell signaling pathways, particularly in collagen metabolism and matrix metalloproteinase regulation. Additionally, it has shown promising results in inhibiting tumor growth and metastasis. This highly specific antibody can also be used in diagnostic applications, such as detecting the presence of RAN protein in patient samples. Researchers and scientists rely on the RAN antibody to gain insights into cellular processes and develop novel therapies for various diseases.
