Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Cathepsin D antibody
The Cathepsin D antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets Cathepsin D, an enzyme involved in various cellular processes. The antibody is colloidal in nature, allowing for easy and efficient binding to its target. It has been extensively tested and validated for use in research applications such as immunohistochemistry, Western blotting, and ELISA.PDIA4 antibody
The PDIA4 antibody is a monoclonal antibody that targets the cell antigen PDIA4. It specifically recognizes and binds to the tyrosine residue on PDIA4, inhibiting its function. PDIA4 plays a crucial role in various cellular processes, including the regulation of interleukin-6 (IL-6) signaling. By blocking PDIA4, this antibody can modulate IL-6 activity and potentially impact inflammatory responses.
IGJ antibody
The IGJ antibody is a specific antibody that targets the immunoglobulin J (IGJ) protein. This protein is involved in the production and secretion of antibodies in the body. The IGJ antibody has been extensively studied and validated using various techniques such as transcription-polymerase chain reaction (PCR), enzyme labeling, particle chemiluminescence, and more. It has been shown to have high affinity and specificity for the IGJ protein, making it an ideal tool for research and diagnostic applications. Additionally, this monoclonal antibody has neutralizing properties, allowing it to inhibit the activity of the IGJ protein. With its low density and ability to detect IGJ in human serum at low plasma levels, this antibody is a valuable asset for any laboratory or research facility working with immunoglobulins.NGAL antibody
The NGAL antibody is a glycoprotein that specifically targets a polypeptide found in mesenchymal stem cells. It is a Monoclonal Antibody that has been developed using adeno-associated virus (AAV) technology. This antibody has neutralizing properties, meaning it can block the activity of the target polypeptide and prevent its function. The NGAL antibody can be used for various applications, including research in the field of Life Sciences, as well as for therapeutic purposes. It is produced through a hybridoma cell line and can be conjugated with maleimide or other molecules to enhance its specificity or functionality. Additionally, this antibody has shown antiviral properties and may have potential applications in the treatment of viral infections.
MARCKS antibody
MARCKS antibody is a neutralizing peptide agent that targets interleukin-6 (IL-6), an important cytokine involved in immune responses. It acts as an anticoagulant by inhibiting the activation of coagulation factors. The monoclonal antibody specifically binds to MARCKS, a protein involved in cell signaling and cytoskeletal regulation. By blocking the interaction between MARCKS and its binding proteins, the antibody disrupts cellular processes such as cell adhesion, migration, and proliferation. Additionally, it has been shown to inhibit the binding of fibrinogen and colony-stimulating factor (M-CSF) to their respective receptors, further modulating cellular responses. This antibody is glycosylated, meaning it has attached glycans or glycopeptides that can affect its stability and activity. Its activated form has been extensively studied for its potential therapeutic applications in autoimmune diseases and cancer.TIGD1 antibody
TIGD1 antibody was raised using the middle region of TIGD1 corresponding to a region with amino acids SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTEL1CAM antibody
The L1CAM antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets L1 cell adhesion molecule (L1CAM), which plays a crucial role in cell-to-cell interactions and neural development. This antibody has been extensively studied and validated for various applications, including immunohistochemistry and Western blotting.ABL1 antibody
The ABL1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target adipose lipase. This monoclonal antibody plays a crucial role in regulating triglyceride lipase activity, which is essential for maintaining lipid homeostasis. Additionally, it has been shown to interact with various growth factors, including endothelial growth factor and hepatocyte growth factor receptor.FAK antibody
FAK antibody is a monoclonal antibody that targets focal adhesion kinase (FAK), a protein involved in cell adhesion and migration. This antibody has been shown to bind specifically to FAK and inhibit its activity. It has also been used in research studies to detect FAK expression in various tissues, including amyloid plaques in Alzheimer's disease. Additionally, FAK antibodies have been used to study the interaction between FAK and other proteins, such as chimeric proteins or tyrosine or peptidyl-prolyl antibodies. In the field of Life Sciences, polyclonal antibodies raised against FAK are commonly used for Western blotting or immunohistochemistry experiments. These antibodies have also been employed in studies investigating the role of FAK in signaling pathways related to brain natriuretic peptide or tissue transglutaminase. Furthermore, FAK antibodies can be utilized in diagnostic assays for detecting FAK antigen levels in human serum samples using techniques like electrode activation.GPI antibody
The GPI antibody is a monoclonal antibody that specifically targets the CD3 receptor, which is expressed on T cells. This antibody has been extensively studied and shown to have various applications in the field of Life Sciences. It has been used in research to investigate the role of CD3 receptor in immune responses and signaling pathways.HSPBP1 antibody
The HSPBP1 antibody is a monoclonal antibody that has been extensively studied in the field of Life Sciences. It has shown great potential in various applications such as molecular docking, immunoassays, and enzyme substrates. This antibody specifically targets HSPBP1, a protein involved in fibrinogen metabolism and microvascular endothelium function.TFR2 antibody
The TFR2 antibody is a highly effective tool in antiestrogen therapy. It specifically targets the histamine H4 receptor, which plays a crucial role in estrogen signaling pathways. By blocking this receptor, the TFR2 antibody effectively inhibits the growth and proliferation of estrogen-dependent tumors.BTN1A1 antibody
BTN1A1 antibody is a monoclonal antibody that specifically targets BTN1A1, a nuclear protein involved in cell growth and differentiation. This antibody has been shown to inhibit the activity of BTN1A1 and can be used as an inhibitor in various research applications. It is particularly effective against HER2-positive breast cancer cells, making it a promising candidate for targeted therapy with trastuzumab. The BTN1A1 antibody recognizes the amino group and carbonyl group of BTN1A1, allowing for precise binding and inhibition of its function. In addition, this antibody has been used in studies related to alpha-synuclein aggregation and nucleotide molecule interactions. With its high specificity and low density, the BTN1A1 antibody is a valuable tool for life sciences research.CEA antibody
The CEA antibody is a monoclonal antibody that specifically targets e-cadherin, a glycoprotein involved in cell adhesion. This antibody is designed to recognize and bind to e-cadherin, inhibiting its activity and preventing cell-cell interactions. The CEA antibody is commonly used in life sciences research and biochemical studies to investigate the role of e-cadherin in various cellular processes.
Rat Macrophage antibody (FITC)
Rat macrophage antibody (FITC) was raised in rabbit using rat macrophages as the immunogen.EPHA5 antibody
The EPHA5 antibody is a highly specialized antibody that targets the epidermal growth factor. It plays a crucial role in various Life Sciences applications, particularly in the study of adipose tissues. This antibody has been shown to affect important cellular processes such as glycosylation and cell adhesion through its interaction with proteins like E-cadherin and β-catenin.CD4 antibody (PE)
CD4 antibody (PE) was raised in mouse using CD4+ transfectant/human CEM as the immunogen.NEK6 antibody
The NEK6 antibody is a highly specialized monoclonal antibody that is used in various applications within the Life Sciences field. It is designed to target and bind to NEK6, an enzyme involved in cell cycle regulation and signaling pathways. This antibody has been extensively tested and validated for its specificity and sensitivity.
CD70 antibody
The CD70 antibody is a monoclonal antibody that targets the CD70 protein. It has been shown to inhibit the activity of phosphatase and nuclear factor kappa-light-chain-enhancer in B cells, leading to decreased polymerase activity and growth factor activation. This antibody also has cytotoxic effects on mycoplasma genitalium, as it activates endonuclease and caspase-9, resulting in cell death. The CD70 antibody is widely used in Life Sciences research and has potential applications in the development of targeted therapies for various diseases.NMT2 antibody
The NMT2 antibody is a highly specialized biological agent that has a range of important applications in the field of Life Sciences. This antibody is known for its high bioavailability and exceptional binding affinity to erythropoietin receptors. It has been extensively studied for its ability to modulate various biological effects, including angiogenic response and the production of polyunsaturated fatty acids such as arachidonic acid.
