Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Rabbit anti Whole Bovine serum antibody (IgG fraction)
Whole bovine serum antibody (IgG fraction) was raised in rabbit using bovine serum as the immunogen.Purity:Min. 95%PPP1R13B antibody
PPP1R13B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAPurity:Min. 95%AIMP2 antibody
AIMP2 antibody was raised in rabbit using the middle region of AIMP2 as the immunogen
Purity:Min. 95%LYRM1 antibody
LYRM1 antibody was raised using the middle region of LYRM1 corresponding to a region with amino acids KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP
BAG2 antibody
BAG2 antibody was raised using the C terminal of BAG2 corresponding to a region with amino acids VDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSK
ACTR1A antibody
ACTR1A antibody was raised using a synthetic peptide corresponding to a region with amino acids AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP
Chicken anti Rabbit IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%Hemocyanin antibody
The Hemocyanin antibody is a valuable product in the field of Life Sciences. This antibody specifically targets fatty acids and is widely used in research involving Antibodies. It acts as a family kinase inhibitor, preventing the activation of kinases that play a crucial role in cell signaling pathways. Additionally, this antibody has been shown to interact with collagen, epidermal growth factor, and interleukin-6, making it an essential tool for studying the effects of these molecules on various biological processes.SET antibody
SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Purity:Min. 95%SYCP1 antibody
SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV
Purity:Min. 95%TBRG4 antibody
The TBRG4 antibody is an antigen-specific antibody that is used in Life Sciences research. It is a polyclonal antibody that specifically targets TBRG4, a protein involved in various cellular processes. This antibody has been widely used in studies related to alpha-fetoprotein, natriuretic peptides, and albumin. It can be used in both monoclonal and polyclonal forms, depending on the specific research needs. The TBRG4 antibody has shown high specificity and sensitivity when used in assays such as ELISA and Western blotting. It has also been used to detect TBRG4 expression in human serum samples and to study its role in interferon signaling and growth factor regulation.
ATF3 antibody
ATF3 antibody was raised in mouse using recombinant Human Activating Transcription Factor 3D-dimer antibody
D-dimer antibody is a monoclonal antibody that specifically targets D-dimer, a protein fragment that is produced when blood clots are broken down. This antibody has antiviral properties and can neutralize the activity of D-dimer, preventing excessive blood clot formation. In addition to its therapeutic use, this antibody is also used in research and diagnostics in the field of Life Sciences. It can be used to study the role of D-dimer in various biological processes, such as wound healing and thrombosis. The formulation of this antibody includes excipients like histidine and insulin to ensure stability and enhance its efficacy.ILK antibody
The ILK antibody is a powerful tool used in scientific research and diagnostics. This monoclonal antibody specifically targets ILK (Integrin-Linked Kinase), a key protein involved in various cellular processes. It plays a crucial role in cell adhesion, migration, proliferation, and survival.
Delangin A antibody
Delangin A antibody was raised in Rat using Delangin peptide coupled to carrier protein as the immunogen.
AFP antibody
The AFP antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of biomedical research. This antibody specifically targets and binds to alpha-fetoprotein (AFP), a human protein that is commonly found in the serum of individuals with certain medical conditions.
EIF4E2 antibody
EIF4E2 antibody was raised in rabbit using the N terminal of EIF4E2 as the immunogen
Purity:Min. 95%SH3RF1 antibody
SH3RF1 antibody was raised using the middle region of SH3RF1 corresponding to a region with amino acids LLKLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHG
CD16 antibody (Allophycocyanin)
CD16 antibody (Allophycocyanin) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)
Purity:Min. 95%Ly108 antibody
The Ly108 antibody is a cytotoxic antibody that belongs to the class of monoclonal antibodies. It has been shown to target and destroy cells expressing Ly108, making it an effective treatment for certain diseases. This antibody has the ability to bind to multiple targets, including autoantibodies, growth factors such as interleukin-6 and interferon, fibronectin, collagen, glycoproteins, and erythropoietin. In the field of life sciences, the Ly108 antibody is widely used for research purposes and in the development of therapeutic drugs. It has also been used in combination with other monoclonal antibodies like trastuzumab to enhance their efficacy. With its versatile targeting capabilities, the Ly108 antibody offers promising potential for various applications in medical and scientific fields.Factor X antibody (HRP)
Factor X antibody (HRP) was raised in goat using human Factor X purified from plasma as the immunogen.
Goat anti Rat IgG (Fab'2) (rhodamine)
Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.
Purity:Min. 95%TLR4 antibody
The TLR4 antibody is a reactive and neutralizing monoclonal antibody that targets Toll-like receptor 4 (TLR4). It is commonly used in research and clinical settings to study the role of TLR4 in various biological processes. This antibody specifically binds to TLR4, preventing its interaction with ligands and downstream signaling molecules. By blocking TLR4 activation, the antibody inhibits the production of pro-inflammatory cytokines such as interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α). Additionally, it has been shown to inhibit the genotoxic effects of certain substances, making it a valuable tool in genotoxicity studies. The TLR4 antibody is widely used in life sciences research, particularly in the fields of immunology and inflammation. Whether you're studying cholinergic signaling or investigating fatty acid metabolism, this antibody can provide valuable insights into cellular processes regulated by TLR4. Choose our high-quality TLR4 antibody for your
Lactoferrin antibody
Lactoferrin antibody was raised in Mouse using purified human lactoferrin as the immunogen.NTRK2 antibody
The NTRK2 antibody is a highly specialized protein that plays a crucial role in the field of Life Sciences. It is an antibody that specifically targets and binds to the NTRK2 protein, which is involved in various cellular processes. This polyclonal antibody can be used for research purposes, such as studying the function and expression of NTRK2 in different cell types and tissues.
PLVAP antibody
The PLVAP antibody is a glycopeptide that belongs to the class of antibodies used in Life Sciences. It is specifically designed to target and bind to PLVAP (Plasmalemma Vesicle-Associated Protein), an important protein involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.
