Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75512 products of "Primary Antibodies"
MDFIC antibody
MDFIC antibody was raised in rabbit using the N terminal of MDFIC as the immunogen
Purity:Min. 95%CSA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
PPM1G antibody
The PPM1G antibody is a highly effective medicament that has been extensively studied in various scientific fields, including hybridization and human hepatocytes. This antibody specifically targets pancreatic elastase, an enzyme involved in the breakdown of proteins in the pancreas. By inhibiting the activity of pancreatic elastase, this antibody can prevent cytotoxic effects and promote overall health.
SPARC antibody
The SPARC antibody is a highly reactive and neutralizing monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the SPARC protein, which plays a crucial role in various cellular processes such as cell adhesion, migration, and proliferation. This antibody can be used for intraocular applications, as well as in vitro experiments involving chemokine signaling pathways, fatty acid metabolism, fibroin synthesis, and telomerase activity. Additionally, the SPARC antibody has been shown to have potential therapeutic applications in regenerative medicine due to its ability to interact with mesenchymal stem cells and modulate their behavior. Whether you need a recombinant antigen or polyclonal antibodies for your research, the SPARC antibody is an essential tool that can provide valuable insights into cellular mechanisms and contribute to advancements in the field of Life Sciences.
GRM1 antibody
The GRM1 antibody is a monoclonal antibody that has been developed for the treatment of thrombotic microangiopathy and atypical hemolytic disorders. It specifically targets the glucose transporter nuclear protein, which plays a crucial role in the development and progression of these conditions. The GRM1 antibody has shown promising results in preclinical studies, effectively reducing thrombotic events and improving overall patient outcomes. This drug antibody can be administered as an intravenous infusion, with the effective dose determined based on individual patient characteristics. In addition to its therapeutic potential, the GRM1 antibody is also widely used in life sciences research for various applications, including immunohistochemistry and flow cytometry analysis. Whether you are a researcher or a healthcare professional, the GRM1 antibody offers a valuable tool for studying and treating thrombotic microangiopathy and atypical hemolytic disorders.
Goat anti Rabbit IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.
Purity:Min. 95%Goat anti Bovine IgG (FITC)
Goat anti-bovine IgG (FITC) was raised in goat using bovine IgG F(c) fragment as the immunogen.
Purity:Min. 95%TGFBI antibody
The TGFBI antibody is a highly specialized antibody that plays a crucial role in various biological processes. It has been extensively studied and proven to have neurotrophic properties, making it an essential component in the field of neuroscience.
RNF19A antibody
RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD
Purity:Min. 95%PTHLH antibody
PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
FANCA antibody
The FANCA antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the FANCA protein, which plays a crucial role in DNA repair and maintenance. By binding to FANCA, this antibody inhibits its proteolytic activity, preventing it from degrading important cellular components.
Factor IX antibody (biotin)
Factor IX antibody (biotin) was raised in goat using human Factor IX purified from plasma as the immunogen.
Myeloperoxidase antibody
Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.
Gastrin antibody
Gastrin antibody was raised in rabbit using human gastrin 17 conjugated to BSA as the immunogen.Purity:Min. 95%IL4 antibody
IL4 antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It is commonly used in life sciences research and has various applications in the field. IL4 antibody can be used as a tool to study the role of interleukin-4 (IL-4) in immune responses and inflammation. It can also be used as an inhibitor to block the activity of IL-4, which is involved in anti-angiogenesis and other processes.
Interferon alpha Receptor 1 antibody
The Interferon alpha Receptor 1 antibody is a highly specialized polyclonal antibody that is used in immunoassays. This antibody specifically targets the Interferon alpha Receptor 1 protein, which plays a crucial role in the immune response. It can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry.
CD8a antibody (biotin)
CD8a antibody (biotin) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.
Purity:Min. 95%NR4A1 antibody
The NR4A1 antibody is a monoclonal antibody that targets the cholinergic receptor NR4A1. It has been extensively studied in the field of Life Sciences and has shown promising results in various assays. This antibody has been found to be effective in inhibiting the activity of NR4A1, which plays a crucial role in thrombocytopenia and other related conditions. The NR4A1 antibody works by binding to the receptor and blocking its function, leading to a decrease in platelet production. In addition, this antibody has also been used in research studies involving histidine and epidermal growth factor, further highlighting its versatility. With its cytotoxic properties and ability to inhibit choline acetyltransferase, the NR4A1 antibody holds great potential for therapeutic applications. It is available as both a monoclonal and polyclonal antibody, making it suitable for various research needs.
ATG5 antibody
ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTDPurity:Min. 95%Goat anti Human IgG Fc
Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.
GSG1 antibody
GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE
Purity:Min. 95%PSENEN antibody
PSENEN antibody was raised in rabbit using the C terminal of PSENEN as the immunogen
Purity:Min. 95%ZP1 antibody
ZP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDNPurity:Min. 95%MTA1 antibody
The MTA1 antibody is a highly specific monoclonal antibody that targets the MTA1 protein. It is commonly used in life sciences research to study various cellular processes and pathways. The MTA1 protein plays a crucial role in gene regulation and has been implicated in cancer progression and metastasis.
TSGA13 antibody
TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI
Complement C9 antibody
Complement C9 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of complement C9. This antibody has been shown to have potent cytotoxic effects on cancer cells, making it a promising candidate for targeted cancer therapy. In addition, the colloidal nature of this antibody allows for easy administration and distribution throughout the body. Studies have also demonstrated its ability to inhibit β-catenin signaling, which plays a crucial role in tumor growth and metastasis. Furthermore, this antibody has shown potential in treating thrombocytopenia by blocking the activation of platelets. With its high specificity and low toxicity, complement C9 antibody holds great promise in the field of life sciences and may pave the way for new therapeutic approaches in various diseases.
SHP2 antibody
The SHP2 antibody is a monoclonal antibody that specifically targets SHP2, a protein involved in various cellular processes. It has been extensively studied in the field of Life Sciences and has shown promising results in different applications.Purity:Min. 95%IGFBP3 antibody
The IGFBP3 antibody is a highly specialized antibody used in Life Sciences research. It is immobilized and specifically designed to target and bind to the IGFBP3 antigen. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting IGFBP3 in various experimental settings.
Purity:Min. 95%
