Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75512 products of "Primary Antibodies"
PREP antibody
PREP antibody was raised using the N terminal of PREP corresponding to a region with amino acids THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF
WDR8 antibody
WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML
DDOST antibody
DDOST antibody was raised using the N terminal of DDOST corresponding to a region with amino acids SPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFD
HN1 antibody
The HN1 antibody is a highly specialized antibody that targets sirtuins, a group of proteins involved in various cellular processes. It serves as a serum marker for the presence of sirtuins and can be used in research or clinical settings to detect their activity. The HN1 antibody has been extensively studied and validated, making it a reliable tool for scientists and medical professionals.
SLC12A5 antibody
The SLC12A5 antibody is a monoclonal antibody that targets the growth factor receptor HER2. It specifically binds to the carbonyl group on HER2, inhibiting its signaling pathway and preventing cell proliferation. This antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the growth of cancer cells that overexpress HER2. Additionally, the SLC12A5 antibody can be used for immobilization on electrodes to study protein-protein interactions or actin filament dynamics. Its high specificity and affinity make it a valuable tool for researchers studying various biological processes. Furthermore, this antibody has cytotoxic activity against cells expressing the antigen CD33, making it a potential therapeutic option for certain types of cancer.
RPL30 antibody
RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE
PPIL3 antibody
PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR
WNT2B antibody
WNT2B antibody was raised using the middle region of WNT2B corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT
S100A11 antibody
The S100A11 antibody is a polyclonal antibody that is used in Life Sciences research. It is specifically designed to neutralize the activity of S100A11 protein in human serum. This antibody is colloidal and activated, making it highly effective in cross-linking with other antibodies or proteins. The S100A11 antibody can be used in various applications, such as Western blotting, immunohistochemistry, and ELISA assays. It has been shown to effectively bind to the target protein complex and induce lysis of cells expressing high levels of S100A11. Additionally, this antibody has been found to have potential therapeutic applications due to its ability to inhibit the production of extracellular polysaccharides.
DHDDS antibody
DHDDS antibody was raised using the N terminal of DHDDS corresponding to a region with amino acids NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR
GPR132 antibody
The GPR132 antibody is a highly specialized chemokine that is activated in human serum. It is widely used in the field of Life Sciences and Antibodies for its ability to target specific growth factors, such as alpha-fetoprotein, and adipose tissues. This monoclonal antibody has a neutralizing effect on receptor binding, making it an effective tool for blocking specific pathways. The GPR132 antibody is commonly used in research settings, where it can be conjugated with colloidal phosphatase or other markers to facilitate detection. Its versatility and effectiveness make it an invaluable tool for studying various biological processes and identifying potential therapeutic targets.
RED antibody
The RED antibody is a monoclonal antibody that specifically targets erythropoietin (EPO). It is designed to neutralize the activity of EPO by inhibiting its endocytic uptake. This antibody has been extensively used in immunoassays to detect and quantify EPO levels in various biological samples. The RED antibody is highly specific and exhibits minimal cross-reactivity with other proteins or molecules. It is produced using state-of-the-art technology and undergoes rigorous quality control to ensure its effectiveness and reliability. In addition, the RED antibody is formulated with excipients that enhance its stability and shelf life. Whether you are conducting research in Life Sciences or developing therapeutic agents, the RED antibody can be a valuable tool for studying EPO-related processes, such as erythropoiesis or the interaction of EPO with human endothelial cells. Its use can also help elucidate the role of EPO in various physiological and pathological conditions. With its high affinity and neutralizing properties, the RED
TFE3 antibody
The TFE3 antibody is a monoclonal antibody that specifically targets CD33, an antigen expressed on the surface of certain cells. It belongs to the class of anti-CD33 antibodies and is widely used in life sciences research. The TFE3 antibody has been shown to bind to CD33 with high affinity, effectively blocking receptor binding and modulating downstream signaling pathways. This antibody can be used for various applications, including flow cytometry, immunohistochemistry, and western blotting. Additionally, the TFE3 antibody has been used in studies investigating autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. Its ability to neutralize TNF-α and inhibit the activation of immune cells makes it a valuable tool in immunology research. Furthermore, this antibody has shown potential therapeutic effects in preclinical models of cancer by targeting CD33-expressing tumor cells. With its versatility and wide range of applications, the TFE3 antibody is an essential tool for
HES1 antibody
The HES1 antibody is a highly activated monoclonal antibody used in Life Sciences research. It specifically targets and binds to HES1, a protein involved in various cellular processes. This antibody has been shown to inhibit the activity of interferon-gamma (IFN-γ), glutamate, and interleukin-6 (IL-6) signaling pathways. Additionally, it can be used for the visualization of actin filaments in cells due to its high specificity towards actin. The HES1 antibody has a high viscosity, making it ideal for applications that require long-term stability and minimal sample loss. Furthermore, this antibody exhibits cytotoxic effects on targeted cells, making it a valuable tool for studies involving cell viability and apoptosis.
MPP3 antibody
MPP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV
GJB2 antibody
GJB2 antibody was raised using the N terminal of GJB2 corresponding to a region with amino acids STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
TFF1 antibody
The TFF1 antibody is a highly specific monoclonal antibody that targets the glutamate receptor. It has cytotoxic properties and can effectively neutralize autoantibodies in the body. The TFF1 antibody is designed to specifically bind to reactive antibodies, preventing them from causing harm to healthy cells. Additionally, this antibody has been shown to inhibit the activity of β-catenin, a protein involved in cell adhesion and signaling pathways.
CDC42 antibody
The CDC42 antibody is a highly specialized antibody that targets the protein CDC42. This protein plays a crucial role in various cellular processes, including cell growth, division, and movement. The CDC42 antibody is designed to bind specifically to CDC42, thereby neutralizing its activity.
COL3A1 antibody
The COL3A1 antibody is a polyclonal antibody that is widely used in Life Sciences research. It specifically targets the COL3A1 gene, which encodes for the collagen type III alpha 1 chain protein. This protein is predominantly found in cardiomyocytes and plays a crucial role in maintaining the structural integrity of the heart. The COL3A1 antibody has been extensively tested and validated for its specificity and sensitivity. It has shown excellent performance in various applications, including Western blotting, immunohistochemistry, and ELISA assays. In addition to its high affinity for the target protein, this antibody also exhibits minimal cross-reactivity with other proteins commonly found in human serum or albumin. This ensures accurate and reliable results in experiments involving complex biological samples. Researchers have also reported successful use of the COL3A1 antibody in combination with other antibodies, such as anti-CD20 antibodies or protein kinase inhibitors. This allows for more comprehensive studies on signaling pathways or cellular interactions involving COL3
GSTO1 antibody
The GSTO1 antibody is a highly specialized antibody that targets specific proteins and molecules in the body. It has been extensively studied for its ability to interact with various substances, including anti-ACTH antibodies, adiponectin, annexin, and adiponectin receptor. The GSTO1 antibody has also been found to inhibit the activity of family kinase inhibitors and fibrinogen.
