Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75512 products of "Primary Antibodies"
Vimentin protein antibody
The Vimentin protein antibody is a powerful tool for conducting antigen-antibody reactions in various research applications. This antibody specifically targets the vimentin protein, which plays a vital role in maintaining cell structure and integrity. It can be used to study vimentin expression levels, localization, and interactions with other proteins.
PSR antibody
The PSR antibody is a highly specialized monoclonal antibody used in various assays and research studies in the field of Life Sciences. It is specifically designed to target alpha-synuclein (α-syn), a protein associated with neurodegenerative disorders such as Parkinson's disease.
Chlorpyrifos antibody
The Chlorpyrifos antibody is a growth factor that specifically targets messenger RNA (mRNA) molecules. It is a monoclonal antibody that is designed to detect and bind to contaminants, such as chlorpyrifos, in various samples. This antibody is widely used in the field of Life Sciences for applications such as immunoassays and polymerase chain reactions (PCR). The Chlorpyrifos antibody offers high specificity and sensitivity, making it an ideal choice for researchers and scientists working in environmental monitoring, agriculture, and toxicology. With its excellent chemical stability and long shelf life, this antibody ensures reliable results and consistent performance. Whether you need to detect chlorpyrifos residues or develop a medicament for exposure prevention, the Chlorpyrifos antibody is your go-to solution. Choose from our wide range of options, including gold nanoparticle-conjugated antibodies or polyclonal antibodies, to suit your specific research needs.
DPYS antibody
DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID
Factor IX antibody
Factor IX antibody was raised in sheep using human Factor IX purified from plasma as the immunogen.
PKC alpha antibody
The PKC alpha antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to protein kinase C alpha (PKC alpha), an enzyme involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.
NNMT antibody
The NNMT antibody is a highly effective medicament used in the field of Life Sciences. It is specifically designed to target and bind to the NNMT protein, enabling researchers to study its functions and interactions in various biological processes. This monoclonal antibody exhibits a strong antigen-antibody reaction, allowing for precise detection and analysis of NNMT in samples.
ATF2 antibody
The ATF2 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications. This antibody specifically targets ATF2, a transcription factor involved in various cellular processes such as DNA repair and apoptosis.
IFNAR1 antibody
The IFNAR1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and bind to the IFNAR1 protein, which plays a crucial role in the immune response. This antibody has been extensively tested and validated for its efficacy in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
FABP3 antibody
The FABP3 antibody is a highly specialized protein used in the field of Life Sciences. It belongs to the group of Polyclonal Antibodies and monoclonal antibodies that are widely used in research and diagnostic applications. This antibody specifically targets FABP3, which stands for fatty acid-binding protein 3.
ALDH1B1 antibody
ALDH1B1 antibody was raised using the middle region of ALDH1B1 corresponding to a region with amino acids GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL
TBRG4 antibody
The TBRG4 antibody is an antigen-specific antibody that is used in Life Sciences research. It is a polyclonal antibody that specifically targets TBRG4, a protein involved in various cellular processes. This antibody has been widely used in studies related to alpha-fetoprotein, natriuretic peptides, and albumin. It can be used in both monoclonal and polyclonal forms, depending on the specific research needs. The TBRG4 antibody has shown high specificity and sensitivity when used in assays such as ELISA and Western blotting. It has also been used to detect TBRG4 expression in human serum samples and to study its role in interferon signaling and growth factor regulation.
CtBP2 antibody
The CtBP2 antibody is a highly specialized antibody that targets the anti-ICOS antibodies. It specifically binds to serum albumin protein and agonist proteins, effectively neutralizing their activity. This antibody has been extensively tested in various laboratory settings, including liver microsomes and drug antibody assays. It has shown potent chemokine-neutralizing properties, making it an essential tool for researchers in the life sciences field. The CtBP2 antibody is available in both polyclonal and monoclonal forms, providing flexibility for different experimental setups. Its activation potential and ability to target autoantibodies and growth factors make it a valuable asset in research studies.
NPY1R antibody
human NPY1R C-terminal peptide immunoge, Affinity purified Rabbit polyclonal NPY1R antibody, lyophilized
CD25 antibody (Azide Free)
CD25 antibody (Azide free) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell as the immunogen.
BBS5 antibody
BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW
ME1 antibody
The ME1 antibody is a monoclonal antibody that targets the ME1 protein. It has been extensively studied in the field of Life Sciences and has shown promising results as a potential family kinase inhibitor. The ME1 antibody specifically binds to the ME1 protein, inhibiting its activity and preventing the activation of growth factors. This antibody has been used in various research studies, including those involving dopamine signaling pathways and cancer cell lines such as MCF-7. In addition, the ME1 antibody can be used in conjunction with other antibodies or inhibitors to study specific cellular processes or pathways. Its specificity and high affinity make it a valuable tool for researchers in the field.
Complement C3 antibody
The Complement C3 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications. This antibody specifically targets the complement component C3, which is an essential protein involved in the immune response. The Complement C3 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. These antibodies are designed to recognize and bind to different epitopes of the C3 protein, ensuring accurate and reliable results. In addition to its role in the immune system, the Complement C3 antibody has been shown to have antiangiogenic properties. It inhibits endothelial cell growth and angiogenesis, making it a valuable tool for studying these processes. The Complement C3 antibody is widely used in various fields of life sciences research, including immunology, molecular biology, and biochemistry. It can be used in techniques such as Western blotting, immunohistochemistry, flow
GPR171 antibody
The GPR171 antibody is a highly specialized monoclonal antibody that targets the GPR171 receptor. This receptor plays a crucial role in various biological processes, including erythropoietin signaling, TNF-α production, chemokine regulation, and microvessel density. The GPR171 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of GPR171.
GALNT7 antibody
The GALNT7 antibody is a highly specific polyclonal antibody that targets GALNT7, an enzyme responsible for adding sugar molecules to proteins. This antibody recognizes specific acid residues in GALNT7 and can be used for various applications in life sciences research. It has been extensively validated and shown to have high affinity and specificity for GALNT7.
IL16 antibody
IL16 antibody is a highly effective polyclonal antibody that specifically targets IL16, a cytokine involved in immune response regulation. This antibody recognizes and binds to the amino group of IL16, neutralizing its activity and preventing it from interacting with its receptors. The IL16 antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to inhibit the growth and proliferation of mesenchymal stem cells and has potential therapeutic applications in cancer treatment. Additionally, this antibody has been used as a tool in studying the role of IL16 in diseases such as asthma, rheumatoid arthritis, and HIV infection. With its high specificity and effectiveness, the IL16 antibody is a valuable tool for researchers in the life sciences field.
MCM7 antibody
The MCM7 antibody is a highly specialized antibody that targets the lipoprotein lipase, an enzyme involved in the breakdown of triglycerides. This polyclonal antibody is widely used in the field of Life Sciences for research purposes and has shown great potential as an antibiotic. It specifically binds to the lipoprotein lipase, inhibiting its activity and preventing the breakdown of triglycerides. Additionally, this antibody has been found to have growth factor-like properties, promoting cell proliferation and differentiation. The MCM7 antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the most suitable option for their experiments. Its high specificity and cytotoxic effects make it a valuable tool in studying adipose tissue metabolism, collagen synthesis, and TGF-beta signaling pathways.
FAST antibody
The FAST antibody is a hormone peptide that plays a crucial role in various biological processes. This antibody specifically targets multidrug resistance-associated protein (MRP), which is involved in drug resistance mechanisms in cancer cells. The FAST antibody has been extensively studied and has shown promising results in inducing apoptosis (cell death) in cancer cells by targeting MRP. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. Additionally, the FAST antibody can be used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. Its ability to specifically bind to MRP makes it a valuable tool for studying drug resistance mechanisms and developing novel therapeutic strategies against cancer.
CYP2A13 antibody
CYP2A13 antibody was raised using the C terminal of CYP2A13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF
