Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
CD71 antibody (Azide Free)
CD71 antibody (Azide free) was raised in rat using CD71/transferrin receptor as the immunogen.
ZNF364 antibody
ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF
DIL2 antibody
The DIL2 antibody is a human monoclonal antibody that belongs to the class of anti-connexin agents. It is used in the field of Life Sciences for various applications. The DIL2 antibody specifically targets and binds to nuclear glycoproteins, making it a valuable tool for studying cellular processes and protein interactions. This monoclonal antibody has been widely used in research to detect and visualize specific proteins of interest, such as c-myc or tyrosine phosphorylated proteins. The DIL2 antibody is available as both a monoclonal and polyclonal form, allowing researchers to choose the best option for their specific experimental needs. With its high specificity and affinity, the DIL2 antibody is an essential tool for any researcher working in the field of molecular biology or immunology.
cFos antibody
The cFos antibody is a highly specialized monoclonal antibody that is designed to target and neutralize the cFos protein. This protein plays a crucial role in cellular growth and development, as well as in the regulation of various biological processes. By binding to the cFos protein, this antibody effectively inhibits its activity and prevents it from carrying out its normal functions.EPO antibody
The EPO antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody is designed to neutralize arginase, an enzyme that plays a crucial role in various biological processes. The EPO antibody has been extensively tested and validated through electrophoresis techniques to ensure its high quality and efficacy.
Anti-PGII antibody
The Anti-PGII antibody is a highly specialized drug antibody that is used in immunoassays within the field of Life Sciences. This antibody specifically targets and neutralizes the effects of PGII, a fatty acid known for its role in adipose tissue. By neutralizing PGII, this antibody helps to regulate viscosity levels and maintain proper adipose function. Additionally, it has been found to have antiestrogen properties and can inhibit the activity of cdk4/6, enzymes involved in cell division. The Anti-PGII antibody is a monoclonal antibody, meaning it is derived from a single clone of cells and offers high specificity and potency in its action. With its ability to target and modulate various biological processes, this antibody holds great promise for research and therapeutic applications within the field of Life Sciences.Purity:≥90% By Sds-PageOCT4 antibody
OCT4 antibody was raised in Mouse using a purified recombinant fragment of OCT4 expressed in E. coli as the immunogen.
BTK antibody
BTK antibody was raised in Mouse using a purified recombinant fragment of BTK expressed in E. coli as the immunogen.
HSV1 antibody (FITC)
HSV1 antibody (FITC) was raised in goat using HSV type 1, strain F as the immunogen.NR4A1 antibody
NR4A1 antibody was raised using the middle region of NR4A1 corresponding to a region with amino acids FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL
MEF2C antibody
The MEF2C antibody is a highly specific monoclonal antibody that targets the MEF2C protein. This protein plays a crucial role in various biological processes, including cholinergic signaling, adeno-associated virus formation inhibition, and growth factor regulation. By binding to MEF2C, this antibody can modulate its activity and potentially impact the function of downstream pathways.
IKK alpha/beta antibody (Phospho-Ser176)
Rabbit polyclonal IKK alpha/beta antibody for detection of the Phospho-Ser176 form of the IKK alpha/beta peptide.
IL3 antibody
IL3 antibody is a polyclonal antibody that specifically targets and binds to IL3, a cytokine involved in the regulation of hematopoiesis. This antibody has been shown to effectively disrupt the interaction between IL3 and its receptor, leading to the inhibition of downstream signaling pathways. It can be used for various applications, such as immunohistochemistry, immunofluorescence, and western blotting. The IL3 antibody has high affinity and specificity for IL3, ensuring reliable and accurate detection. Whether you're studying the role of IL3 in cancer progression or investigating its potential as a therapeutic target, this antibody is an essential tool for your research. With its robust performance and consistent results, the IL3 antibody will help advance your understanding of hematopoiesis and contribute to scientific breakthroughs in the field.
FBXL20 antibody
FBXL20 antibody was raised in rabbit using the middle region of FBXL20 as the immunogen
alpha Actinin 1 antibody
alpha Actinin 1 antibody was raised using the N terminal of ACTN1 corresponding to a region with amino acids DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
TADA1L antibody
TADA1L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
p16 antibody
P16 antibody was raised in Mouse using a purified recombinant fragment of P16 expressed in E. coli as the immunogen.Factor VIII antibody
Factor VIII antibody was raised in mouse using human factor VIII as the immunogen.
PFKP antibody
The PFKP antibody is a highly specialized monoclonal antibody that targets the protein kinase enzyme. It has been extensively studied for its potential therapeutic applications in various fields, including interferon research, non-alcoholic steatohepatitis treatment, and industrial protein kinase inhibitors.
Pseudomonas aeruginosa Exotoxin A antibody
Goat polyclonal Pseudomonas aeruginosa Exotoxin A antibody
Sheep RBC antibody (Texas Red)
Sheep RBC antibody (Texas Red) was raised in rabbit using sheep erythrocytes as the immunogen.
RORA antibody
RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
