Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
ApoE antibody
Apolipoprotein E antibody was raised in mouse using human apolipoprotein E as the immunogen.
APE1 antibody
The APE1 antibody is a highly specific monoclonal antibody that targets endoplasmic reticulum aminopeptidase 1 (APE1). It is used in Life Sciences research to study the role of APE1 in various cellular processes. This antibody has been shown to neutralize the activity of APE1, which is involved in DNA repair and redox regulation. It can be used for immunoprecipitation, Western blotting, and immunofluorescence experiments. The APE1 antibody has been validated using mass spectrometric methods and has been shown to specifically recognize APE1 in nuclear extracts. It can also be immobilized on an electrode for use in electrochemical assays. With its high specificity and versatility, the APE1 antibody is an essential tool for researchers studying growth factors, signal transduction pathways, and DNA repair mechanisms.
PTGER1 antibody
The PTGER1 antibody is a highly specialized polyclonal antibody that is designed to specifically target and bind to the PTGER1 antigen. This antibody is widely used in research and life sciences applications, particularly in the study of alpha-synuclein and its role in various diseases and conditions. The PTGER1 antibody has been shown to have a high affinity for the PTGER1 antigen, making it an ideal tool for detecting and quantifying the presence of this protein in samples. Additionally, this antibody has been extensively validated for use in techniques such as immunohistochemistry, immunofluorescence, and Western blotting. Its exceptional specificity ensures reliable and accurate results, making it an invaluable asset for researchers working in the fields of neuroscience, cell biology, and molecular biology. With its ability to provide detailed insights into the expression patterns and localization of PTGER1, this antibody opens up new avenues for understanding the complex mechanisms underlying various diseases and holds great promise for future therapeutic development.
XIAP antibody
The XIAP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to X-linked inhibitor of apoptosis protein (XIAP), a glycoprotein that plays a crucial role in cell survival and death pathways. This antibody has been extensively tested and validated for its specificity and sensitivity.
SAMHD1 antibody
The SAMHD1 antibody is a neuroprotective globulin that is used in the field of Life Sciences. It is a monoclonal antibody that targets SAMHD1, an inhibitory factor involved in various cellular processes. This antibody has been shown to neutralize the activity of SAMHD1 and has potential applications in research and therapeutic development. The SAMHD1 antibody is highly specific and exhibits high affinity for its target. It can be used in various assays, including immunohistochemistry, Western blotting, and flow cytometry. This product is available as a monoclonal antibody with excipients to ensure stability and long shelf life. The SAMHD1 antibody is glycosylated, which enhances its binding efficiency and overall performance. With its unique properties, this antibody offers great potential for advancing scientific discoveries in the field of neuroprotection and beyond.
NMNAT1 antibody
NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL
ATM antibody
The ATM antibody is a highly specialized monoclonal antibody that has been designed to target and bind to the ATM protein. This protein plays a crucial role in the DNA damage response pathway and is involved in cell cycle regulation, DNA repair, and apoptosis. The ATM antibody can be used in various research applications, including molecular docking studies, immunoassays, and hybridization experiments. It has been shown to specifically recognize and form a complex with the epidermal growth factor (EGF)-like domain of the ATM protein. Additionally, the ATM antibody exhibits high affinity for albumin, a major component of human serum. Its unique binding properties make it an invaluable tool for scientists working in the field of life sciences who are studying cellular processes related to DNA damage and repair.
IL7 antibody
IL7 antibody is a highly specific antibody that targets interleukin-7 (IL-7), a cytokine involved in the regulation of immune cell development and function. This antibody is widely used in Life Sciences research, particularly in studies related to immunology and inflammation. IL7 antibody is commonly used for various applications, including immunoassays, western blotting, immunohistochemistry, and flow cytometry.
Protein C antibody
Protein C antibody is a valuable tool in Life Sciences research. It is an antibody that specifically targets and binds to Protein C, an important protein involved in the anticoagulant pathway. This antibody can be used for various applications, including studying the role of Protein C in coagulation processes, investigating its glycosylation patterns, and exploring its interactions with other molecules such as fibrinogen.
TOP2B antibody
The TOP2B antibody is a polyclonal antibody that targets the topoisomerase II beta (TOP2B) enzyme. This enzyme plays a crucial role in DNA replication and repair, making it an important target for research in the field of life sciences. The TOP2B antibody has been shown to be effective in neutralizing the activity of TOP2B, inhibiting its function and preventing DNA damage.
EDG6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
MMACHC antibody
The MMACHC antibody is a monoclonal antibody that targets oncostatin and e-cadherin expression. It is commonly used in Life Sciences research to study the role of these proteins in various cellular processes. This antibody specifically binds to e-cadherin, a protein involved in cell adhesion and tissue integrity. By targeting e-cadherin, the MMACHC antibody can provide valuable insights into cell signaling pathways and cellular interactions. Additionally, this antibody has been shown to be effective in detecting osteopontin, a protein associated with bone remodeling and cancer metastasis. The MMACHC antibody can be used for various applications such as immunohistochemistry, Western blotting, and flow cytometry. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying protein-protein interactions and cellular mechanisms.
Rat anti Mouse IgA (biotin)
Rat anti-mouse IgA (biotin) was raised in rat using murine IgA as the immunogen.
Filamin B antibody
The Filamin B antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets Filamin B, an important protein involved in various cellular processes. This antibody has been extensively tested and validated for its high specificity and sensitivity.
RALY antibody
RALY antibody was raised using the C terminal of RALY corresponding to a region with amino acids GGGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQDT
NR2F1 antibody
NR2F1 antibody was raised using the C terminal of NR2F1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
DDT antibody
The DDT antibody is a highly specialized monoclonal antibody that targets and binds to DDT (dichlorodiphenyltrichloroethane), a pesticide commonly used in the past. This antibody exhibits high specificity and affinity for DDT, making it an effective tool for research and diagnostic applications.
Caspase 3 antibody
The Caspase 3 antibody is a highly specific monoclonal antibody that targets the caspase 3 protein. Caspase 3 is an important enzyme involved in programmed cell death, also known as apoptosis. This antibody is widely used in life sciences research to study the role of caspase 3 in various cellular processes.
CRP antibody
The CRP antibody is a highly versatile and effective tool for research in the field of immunology. It is designed to specifically target and neutralize C-reactive protein (CRP), a key component of the immune response. This monoclonal antibody has been extensively tested and proven to have high affinity and specificity for CRP.
GNB2 antibody
GNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR
ASL antibody
The ASL antibody is a monoclonal antibody that is specifically designed to target and bind to the antigen ASL. This antibody is produced by hybridoma cells, which are created by fusing myeloma cells with B cells that have been immunized with the ASL antigen. The resulting hybridoma cell strain produces large quantities of this specific antibody.
