Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
CacyBP antibody
The CacyBP antibody is a powerful tool in the field of Life Sciences. It is an anti-mesothelin antibody that has been extensively studied for its potential therapeutic applications. Mesothelin is a cell surface glycoprotein that is highly expressed in various cancers, making it an attractive target for cancer therapy.
IDH3A antibody
IDH3A antibody was raised using a synthetic peptide corresponding to a region with amino acids RHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRVKDL
CKMB Antibody
The CKMB Antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is specifically designed to target and bind to the CKMB protein, which is an important biomarker for various cardiac conditions.Rad54 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits strong bactericidal activity. It works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
GRB2 antibody
The GRB2 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It has been developed to target and bind specifically to the GRB2 protein, which plays a crucial role in cell signaling pathways. This antibody can be used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
Caspase 8 antibody
The Caspase 8 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It plays a crucial role in various biological processes, including natriuretic regulation, growth factor signaling, and medicament development. This antibody specifically targets caspase 8, an enzyme involved in cellular apoptosis.
Thyroid Peroxidase antibody
Thyroid Peroxidase antibody is a monoclonal antibody that targets the thyroid peroxidase enzyme. This enzyme plays a crucial role in the synthesis of thyroid hormones. By binding to the enzyme, Thyroid Peroxidase antibody inhibits its activity, leading to a decrease in thyroid hormone production. This antibody has been extensively used in research and diagnostic applications in the field of Life Sciences. It has shown great potential for studying cholinergic signaling pathways, genotoxic effects, fatty acid metabolism, and neutralizing specific proteins such as collagen and acetylcholine. With its high specificity and affinity, Thyroid Peroxidase antibody is an essential tool for researchers working in various areas of biology and medicine.MTHFD2 antibody
MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE
COL1A1 antibody
The COL1A1 antibody is a polyclonal antibody that specifically targets collagen type I alpha 1 chain. It can be used in various research applications, including immunohistochemistry and western blotting. This antibody plays a crucial role in the study of lipoprotein lipase and its interaction with collagen. Additionally, it has been shown to have potential therapeutic applications in diseases such as trastuzumab-resistant breast cancer.
PPM1B antibody
The PPM1B antibody is a monoclonal antibody that targets the phosphatase enzyme PPM1B. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically recognizes and binds to PPM1B, inhibiting its activity and preventing its interaction with other molecules.
Lactadherin antibody
The Lactadherin antibody is a powerful tool used in the field of Life Sciences. This antibody has shown to have cytotoxic effects on tumor cells and can inhibit the growth of microvessels, which are essential for tumor development. It specifically targets TNF-α, a cytokine involved in inflammation and immune response. The Lactadherin antibody can be used in combination with other antibodies, such as adalimumab, to enhance its therapeutic effects. It works by activating protein kinases and phosphatases, which regulate cell growth and survival pathways. Whether you need a polyclonal or monoclonal antibody, the Lactadherin antibody is an excellent choice for your research needs.
SOD2 antibody
The SOD2 antibody is a polyclonal antibody that specifically targets the superoxide dismutase 2 (SOD2) protein. This antibody is commonly used in life sciences research to study the role of SOD2 in various cellular processes.
R3HDM2 antibody
R3HDM2 antibody was raised using the middle region of R3HDM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG
PDIA4 antibody
The PDIA4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the PDIA4 antigen, which is an extracellular enzyme involved in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying PDIA4 levels in human serum samples.
NFS1 antibody
NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV
Cystatin B antibody
The Cystatin B antibody is a highly specific and reliable tool for detecting and measuring Cystatin B levels in human serum samples. This polyclonal antibody has been extensively validated and shows excellent performance in various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry.
PDPN antibody
The PDPN antibody is a monoclonal antibody used in the field of Life Sciences. It is commonly known as an antiphospholipid antibody and has been extensively studied for its role in various biological processes. This antibody specifically targets podoplanin, a glycoprotein expressed on the surface of many cell types.
HSF2 antibody
The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.
PGR antibody
PGR antibody was raised in Mouse using a purified recombinant fragment of PGR(aa730-871) expressed in E. coli as the immunogen.Kaptin antibody
Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL
BAK1 antibody
The BAK1 antibody is a test compound used in Life Sciences research. It is a protein reagent that is commonly used in the field of Antibodies. This antibody specifically targets hematopoietic cells and can be used to study their function in various biological processes. The BAK1 antibody has high affinity for its target and can be used as an inhibitor to block specific interactions or signaling pathways. Additionally, it has been shown to have therapeutic potential in the field of pluripotent stem cell research, where it can be used to manipulate DNA double-strand breaks and promote cellular differentiation. With its versatility and wide range of applications, the BAK1 antibody is an essential tool for researchers in the Life Sciences field.
Triiodothyronine antibody
Triiodothyronine antibody is a monoclonal antibody that specifically targets and inhibits the activity of tyrosine kinase receptors. It is commonly used in life sciences research to study the role of these receptors in various cellular processes. Triiodothyronine antibody has been shown to effectively neutralize the growth factor signaling pathway by blocking the interaction between growth factors and their receptors. This inhibition leads to a decrease in cell proliferation and survival. Additionally, this antibody can be used in cytotoxic assays to assess the efficacy of tyrosine kinase inhibitors, such as imatinib. The binding of triiodothyronine antibody to its target receptor also results in dephosphorylation events mediated by phosphatases, which further modulate cellular responses. Its specificity and ability to inhibit tyrosine kinase activity make triiodothyronine antibody a valuable tool for studying signal transduction pathways and developing targeted therapies against diseases driven by aberrant receptor activation.
