Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
RALA antibody
The RALA antibody is a glycopeptide that acts as an anticoagulant by neutralizing the viscosity of fibrinogen. It belongs to the class of peptide agents known as antibodies, which are widely used in Life Sciences research. This antibody specifically binds to glycan-binding proteins and has been shown to have toxic effects on various cell types. Additionally, it has been found to inhibit the activity of colony-stimulating factors such as interleukin-6, making it a valuable tool for studying immune responses and cell signaling pathways. The RALA antibody is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein, increasing its versatility in experimental applications.
PKC alpha antibody
The PKC alpha antibody is a highly specialized antibody that targets the protein kinase C alpha (PKCα) enzyme. It is commonly used in life sciences research to study various cellular processes and signaling pathways. This monoclonal antibody specifically binds to the activated form of PKCα, allowing researchers to detect and analyze its activity in different cell types.
FBXL5 antibody
FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES
Factor V antibody
Factor V antibody was raised in sheep using human factor V purified from plasma as the immunogen.
KSHV K8 alpha antibody
KSHV K8 alpha antibody was raised in Mouse using a purified recombinant fragment of KSHV K8alpha expressed in E. coli as the immunogen.Oxytocin antibody
The Oxytocin antibody is a highly specialized monoclonal antibody that has been activated and designed to target and inhibit the effects of oxytocin. This antibody specifically binds to histidine residues in the oxytocin molecule, blocking its activity and preventing it from binding to its receptors.
PPIL3 antibody
PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK
Apelin Receptor antibody
Apelin Receptor antibody is a monoclonal antibody that specifically targets the apelin receptor, a G-protein coupled receptor involved in various physiological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to alpha-fetoprotein, acidic androgen protein, autoantibodies, lysozyme, leukemia inhibitory factor, glycosylation, arginase, and other related factors. The Apelin Receptor antibody is widely used as a research tool for studying the role of apelin signaling pathways and its potential therapeutic applications. With its high specificity and inhibitory effects on apelin receptor activation, this antibody offers valuable insights into understanding the complex mechanisms underlying various biological processes.
GNL3L antibody
GNL3L antibody was raised using a synthetic peptide corresponding to a region with amino acids MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN
AGXT2L1 antibody
AGXT2L1 antibody was raised using the middle region of AGXT2L1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT
SLC7A8 antibody
SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA
CHRNB3 antibody
CHRNB3 antibody was raised in rabbit using the middle region of CHRNB3 as the immunogen
HNRPLL antibody
HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
PRUNE antibody
The PRUNE antibody is a monoclonal antibody that specifically targets the cysteine-rich protein known as PRUNE. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. PRUNE is a multifunctional protein that acts as a growth factor and glycoprotein, playing a crucial role in cellular processes.
PSAT1 antibody
The PSAT1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the PSAT1 protein, which plays a crucial role in cellular metabolism and growth regulation. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA).
MCM3 antibody
The MCM3 antibody is a monoclonal antibody that specifically targets the growth factor MCM3. It acts as a neutralizing agent, inhibiting the activity of MCM3 and preventing its activation. This antibody has been widely used in Life Sciences research, particularly in studies involving trastuzumab, an anti-HER2 antibody. By blocking the interaction between MCM3 and epidermal growth factor receptors, this antibody effectively disrupts signaling pathways involved in cell growth and proliferation.
GPR132 antibody
The GPR132 antibody is a highly specialized chemokine that is activated in human serum. It is widely used in the field of Life Sciences and Antibodies for its ability to target specific growth factors, such as alpha-fetoprotein, and adipose tissues. This monoclonal antibody has a neutralizing effect on receptor binding, making it an effective tool for blocking specific pathways. The GPR132 antibody is commonly used in research settings, where it can be conjugated with colloidal phosphatase or other markers to facilitate detection. Its versatility and effectiveness make it an invaluable tool for studying various biological processes and identifying potential therapeutic targets.
RED antibody
The RED antibody is a monoclonal antibody that specifically targets erythropoietin (EPO). It is designed to neutralize the activity of EPO by inhibiting its endocytic uptake. This antibody has been extensively used in immunoassays to detect and quantify EPO levels in various biological samples. The RED antibody is highly specific and exhibits minimal cross-reactivity with other proteins or molecules. It is produced using state-of-the-art technology and undergoes rigorous quality control to ensure its effectiveness and reliability. In addition, the RED antibody is formulated with excipients that enhance its stability and shelf life. Whether you are conducting research in Life Sciences or developing therapeutic agents, the RED antibody can be a valuable tool for studying EPO-related processes, such as erythropoiesis or the interaction of EPO with human endothelial cells. Its use can also help elucidate the role of EPO in various physiological and pathological conditions. With its high affinity and neutralizing properties, the RED
TFE3 antibody
The TFE3 antibody is a monoclonal antibody that specifically targets CD33, an antigen expressed on the surface of certain cells. It belongs to the class of anti-CD33 antibodies and is widely used in life sciences research. The TFE3 antibody has been shown to bind to CD33 with high affinity, effectively blocking receptor binding and modulating downstream signaling pathways. This antibody can be used for various applications, including flow cytometry, immunohistochemistry, and western blotting. Additionally, the TFE3 antibody has been used in studies investigating autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. Its ability to neutralize TNF-α and inhibit the activation of immune cells makes it a valuable tool in immunology research. Furthermore, this antibody has shown potential therapeutic effects in preclinical models of cancer by targeting CD33-expressing tumor cells. With its versatility and wide range of applications, the TFE3 antibody is an essential tool for
HES1 antibody
The HES1 antibody is a highly activated monoclonal antibody used in Life Sciences research. It specifically targets and binds to HES1, a protein involved in various cellular processes. This antibody has been shown to inhibit the activity of interferon-gamma (IFN-γ), glutamate, and interleukin-6 (IL-6) signaling pathways. Additionally, it can be used for the visualization of actin filaments in cells due to its high specificity towards actin. The HES1 antibody has a high viscosity, making it ideal for applications that require long-term stability and minimal sample loss. Furthermore, this antibody exhibits cytotoxic effects on targeted cells, making it a valuable tool for studies involving cell viability and apoptosis.
