Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
IL8 antibody
The IL8 antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and bind to interleukin-8 (IL-8), a chemokine involved in inflammation and immune response. This antibody has shown great potential in various research applications, including immunohistochemistry, where it can be used to detect IL-8 expression in tissue samples.
KLK5 antibody
The KLK5 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It acts as an inhibitor of endothelial growth factor, acidic neurotrophic factor, and colloidal antibodies. Additionally, it has neutralizing properties against glucagon and tyrosine growth factor.
CPA1 antibody
The CPA1 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α), a protein involved in inflammatory responses. This antibody has shown efficacy in blocking the activity of TNF-α, which plays a crucial role in various diseases and conditions. Studies have also demonstrated that the CPA1 antibody can inhibit the production of interleukin-6 and interferon, both of which are involved in immune responses. Additionally, this monoclonal antibody has been shown to bind to transferrin, a biomolecule involved in iron transport, as well as nuclear receptors. The CPA1 antibody holds promise for therapeutic applications due to its ability to target specific proteins and disrupt protein complexes involved in disease pathogenesis.
MRTO4 antibody
MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKL
Delangin A antibody
Delangin A antibody was raised in Rat using Delangin peptide coupled to carrier protein as the immunogen.
JAK2 antibody
JAK2 antibody was raised in Mouse using a purified recombinant fragment of JAK2(745-955aa) expressed in E. coli as the immunogen.
RAVER2 antibody
RAVER2 antibody was raised using the middle region of RAVER2 corresponding to a region with amino acids TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL
CHUK antibody
CHUK antibody was raised in Mouse using a purified recombinant fragment of human CHUK expressed in E. coli as the immunogen.
V5 Tag antibody
The V5 Tag antibody is a monoclonal antibody used in Life Sciences research. It specifically binds to the V5 epitope, a small peptide sequence that is commonly fused to target proteins for detection and purification purposes. This antibody is widely used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
Aggrecan antibody
The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.
CD33 antibody
CD33 antibody was raised in Mouse using a purified recombinant fragment of CD33(48-258) expressed in E. coli as the immunogen.Dengue NS1 antibody
The Dengue NS1 antibody is a cytotoxic monoclonal antibody that belongs to the class of antibodies known as anti-VEGF (vascular endothelial growth factor). It is widely used in the field of Life Sciences for various applications. This antibody has been shown to have nephrotoxic effects and can be used as an electrode-activated growth factor in endogenous hematopoietic cells. Additionally, it has acidic properties and may interact with insulin, fatty acid, and glucagon receptors. The Dengue NS1 antibody is highly specific and binds to markers expressed at high levels in dengue virus-infected cells, inhibiting viral replication and promoting immune response.
RARA antibody
The RARA antibody is a neutralizing monoclonal antibody that targets the endothelial growth factor. It has been shown to inhibit the growth and proliferation of cells involved in angiogenesis, making it a promising therapeutic option for various diseases related to abnormal blood vessel formation. This antibody specifically binds to fibronectin and collagen, forming a protein complex that disrupts the signaling pathways involved in angiogenesis. In addition, the RARA antibody has been found to have inhibitory effects on alpha-fetoprotein, a growth factor associated with certain types of cancer. Its potential applications in the field of life sciences make it an exciting area of research and development.
BAAT antibody
BAAT antibody was raised using the N terminal of BAAT corresponding to a region with amino acids IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR
BOP1 antibody
BOP1 antibody was raised using the N terminal of BOP1 corresponding to a region with amino acids MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDS
PGP9.5 antibody
PGP9.5 antibody was raised in mouse using recombinant human PGP9.5 (1-223aa) purified from E. coli as the immunogen.
