Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
USP4 antibody
USP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%RAB5A antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The efficacy of this drug has been extensively tested using advanced techniques such as the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
TFEB antibody
The TFEB antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the transcription factor EB (TFEB), a protein involved in the regulation of various cellular processes. This antibody has been shown to be effective in detecting TFEB in different tissues and cell types, including adipose tissue. By binding to TFEB, this antibody can help researchers study its role in cellular processes such as autophagy, lysosomal biogenesis, and lipid metabolism.
Myoglobin antibody
Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
pan Cytokeratin antibody
pan Cytokeratin antibody was raised in Mouse using a purified recombinant fragment of Cytokeratin 5 expressed in E. coli as the immunogen.STT3B antibody
The STT3B antibody is a powerful tool in the field of Life Sciences. It is widely used in research and diagnostic applications due to its high specificity and sensitivity. This antibody has been extensively tested and proven to be effective in various experiments.
CD137L antibody
CD137L antibody was raised in rabbit using highly pure recombinant human 4-1BBL as the immunogen.
Chicken anti Rabbit IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%Podoplanin antibody
The Podoplanin antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the glial fibrillary acidic protein (GFAP), which is predominantly found in astrocytes. This antibody plays a crucial role in studying the function and behavior of astrocytes, as well as their involvement in various neurological disorders.
PSMD4 antibody
The PSMD4 antibody is a neutralizing monoclonal antibody that targets antiphospholipid antibodies. It is used as a test substance in various research applications, including in vitro and in vivo studies. This antibody specifically binds to the PSMD4 protein, which is an essential component of the 26S proteasome. The PSMD4 antibody has been shown to effectively neutralize the activity of autoantibodies, preventing their harmful effects on cells and tissues. It can be used in immunoassays to detect the presence of PSMD4 or as a tool for studying its function and interactions with other molecules. With its high specificity and affinity for PSMD4, this monoclonal antibody is a valuable resource for researchers in the field of Life Sciences.
IL4 antibody
The IL4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes interleukin-4 (IL-4), a glycan involved in various biological processes. This antibody has been extensively studied for its potential therapeutic applications.
ANGPTL4 antibody
The ANGPTL4 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and neutralizes ANGPTL4, a human enzyme involved in plasma lipoprotein metabolism. This antibody can be used for various applications such as collagen polymerase chain reaction (PCR) hybridization, studying the role of ANGPTL4 in plasma lipoprotein regulation, and developing new therapeutic strategies for metabolic disorders.
NODAL antibody
NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ
Troponin T Type 2 antibody
Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE
PD1 antibody
PD1 antibody is a protein that belongs to the family of antibodies. It plays a crucial role in regulating the immune response and preventing autoimmune diseases. PD1 antibody binds to the programmed cell death protein 1 (PD-1), which is expressed on the surface of T cells, B cells, and other immune cells. By binding to PD-1, this antibody blocks its interaction with programmed death-ligand 1 (PD-L1) and programmed death-ligand 2 (PD-L2), inhibiting the inhibitory signals that suppress T cell activation.
TH antibody
TH antibody is a monoclonal antibody that targets the growth factor known as epidermal growth factor (EGF). It specifically binds to EGF and inhibits its activity, making it an effective tool for research in the field of Life Sciences. This antibody has been used in various studies to investigate the role of EGF in different biological processes. Additionally, TH antibody has shown neuroprotective properties by reducing dopamine levels in the brain. It can be used in experiments involving electrode recordings or binding protein analysis. Whether you're studying cell signaling pathways or developing new therapeutic approaches, TH antibody is a valuable tool for your research.
CtIP antibody
The CtIP antibody is a powerful diagnostic agent that is used in Life Sciences research. It acts as a parp inhibitor, which means it inhibits the activity of poly(ADP-ribose) polymerase (PARP), an enzyme involved in DNA repair. This antibody is luminescent and can be detected using particle chemiluminescence or other detection methods. It specifically targets CtIP, a protein involved in DNA recombination and repair, making it an essential tool for studying these processes. The CtIP antibody can be conjugated to streptavidin or magnetic particles for easy detection and purification. Whether you are conducting research or developing new therapies, this antibody is a valuable tool for understanding and manipulating cellular processes.
CD106 antibody (Azide Free)
CD106 antibody (Azide free) was raised in rat using murine CD106/VCAM-1 as the immunogen.
Purity:Min. 95%BIK antibody
The BIK antibody is a monoclonal antibody that targets the epidermal growth factor receptor (EGFR) pathway. It is commonly used in life sciences research to study EGFR signaling and its role in various cellular processes. The BIK antibody specifically binds to activated EGFR, inhibiting its downstream signaling and preventing cell growth and proliferation. This antibody has also been shown to have anti-CD20 activity, making it a useful tool for studying B-cell biology. Additionally, the BIK antibody can be used in immunohistochemistry and Western blotting techniques to detect the presence of EGFR in tissue samples. Its high specificity and sensitivity make it an excellent choice for researchers studying the role of EGFR in cancer, development, and other biological processes.
Annexin A1 antibody
The Annexin A1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It plays a crucial role in various cellular processes, including hepatocyte growth, epidermal growth factor signaling, and TGF-beta regulation. This antibody has been shown to neutralize the effects of growth factors such as transferrin and promote cellular homeostasis. With its high specificity and affinity for Annexin A1, this antibody can effectively bind to the protein and modulate its activity.
Adiponectin antibody
The Adiponectin antibody is a monoclonal antibody that specifically targets and inhibits the formation of adiponectin, a protein found in human serum. Adiponectin plays a crucial role in regulating insulin sensitivity and lipid metabolism, making it an important target for research in the field of Life Sciences. This antibody effectively blocks the interaction between adiponectin and its receptors, preventing downstream signaling pathways involved in hepatic steatosis and interferon production. By inhibiting the formation of TGF-β1, the Adiponectin antibody also has potential therapeutic applications in conditions such as ischemia-reperfusion injury. The high specificity and affinity of this monoclonal antibody ensure reliable results in antigen-antibody reactions. It can be used in various techniques, including particle reactions and cellulose-based assays. Researchers can rely on its performance to accurately detect and quantify adiponectin levels in different biological samples. Overall, the Adiponectin antibody
Alkaline Phosphatase antibody
The Alkaline Phosphatase antibody is a highly specialized antibody that targets the phosphatase enzyme. This antibody is widely used in Life Sciences research for various applications, including the detection and quantification of phosphatase activity in biological samples. It can also be used to study the role of phosphatases in signaling pathways, cell differentiation, and disease progression.
