Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
PCBP3 antibody
PCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
TKTL1 antibody
TKTL1 antibody was raised using the middle region of TKTL1 corresponding to a region with amino acids QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA
PREP antibody
PREP antibody was raised using the N terminal of PREP corresponding to a region with amino acids THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF
WDR8 antibody
WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML
VAMP5 antibody
VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
TRIM9 antibody
The TRIM9 antibody is a highly specialized polyclonal antibody that targets TNF-α, a key cytokine involved in inflammation and immune response. This antibody is also available in a monoclonal form for specific targeting of TNF-α. It has been shown to have neutralizing properties, effectively blocking the activity of TNF-α and preventing its binding to its receptors.
TACC3 antibody
The TACC3 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets TACC3, which stands for transforming acidic coiled-coil-containing protein 3. TACC3 is involved in cell division, growth regulation, and development.
Helicobacter pylori antibody (HRP)
Helicobacter pylori antibody (HRP) was raised in rabbit using ATCC strain 43504 as the immunogen.FYN antibody
The FYN antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the activated form of the FYN protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to effectively inhibit the activity of FYN, making it an invaluable tool for researchers studying signal transduction pathways and cellular signaling.
Glycine Receptor alpha 2 antibody
Affinity purified Rabbit polyclonal Glycine Receptor alpha 2 antibody
Apoptosis enhancing nuclease antibody
Affinity purified Rabbit polyclonal Apoptosis enhancing nuclease antibody
GANP antibody
GANP antibody is a monoclonal antibody that targets the GANP protein. This protein plays a crucial role in various cellular processes, including histidine metabolism, epidermal growth factor signaling, and β-catenin regulation. By specifically binding to GANP, this antibody inhibits its function and disrupts the normal cellular processes associated with it.
ELF5 antibody
The ELF5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in studying neurotrophic factors and their effects on progesterone concentration and steroid metabolism. This antibody is specifically designed to target and bind to ELF5, a transcription factor involved in the regulation of various angiogenic factors such as arginase, angptl3, TGF-beta, and growth factor-2.
CD8 antibody
The CD8 antibody is a monoclonal antibody that belongs to the family of kinase inhibitors. It is widely used in Life Sciences for its cytotoxic properties. The CD8 antibody targets specific protein complexes and inhibits their function, leading to cell death through apoptosis. This monoclonal antibody has been shown to be effective against various diseases and conditions, including hepatic lipase activity, dopamine regulation, vasoactive intestinal peptide signaling, and necrosis factor-related apoptosis-inducing pathways. With its potent inhibitory effects, the CD8 antibody offers promising therapeutic potential in the field of molecular biology and immunology.
FKBP52 antibody
The FKBP52 antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to FKBP52, an important protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting autoantibodies, histidine residues, alkaline phosphatases, epidermal growth factor (EGF), transforming growth factor-beta1 (TGF-beta1), and other growth factors.
CDK2 antibody
The CDK2 antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase 2 (CDK2) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. It has been found to be effective in inhibiting the growth of hepatocyte, promoting natriuretic activity, and regulating fibrinogen activation. The CDK2 antibody is also known for its histidine glycosylation properties, which enhance its stability and binding affinity. Additionally, this antibody has been used in the detection and quantification of autoantibodies and steroids. With its high specificity and reliability, the CDK2 antibody is a valuable tool for researchers in need of accurate and precise measurements in their studies.
MCM3 antibody
The MCM3 antibody is a monoclonal antibody that specifically targets the growth factor MCM3. It acts as a neutralizing agent, inhibiting the activity of MCM3 and preventing its activation. This antibody has been widely used in Life Sciences research, particularly in studies involving trastuzumab, an anti-HER2 antibody. By blocking the interaction between MCM3 and epidermal growth factor receptors, this antibody effectively disrupts signaling pathways involved in cell growth and proliferation.
GPR132 antibody
The GPR132 antibody is a highly specialized chemokine that is activated in human serum. It is widely used in the field of Life Sciences and Antibodies for its ability to target specific growth factors, such as alpha-fetoprotein, and adipose tissues. This monoclonal antibody has a neutralizing effect on receptor binding, making it an effective tool for blocking specific pathways. The GPR132 antibody is commonly used in research settings, where it can be conjugated with colloidal phosphatase or other markers to facilitate detection. Its versatility and effectiveness make it an invaluable tool for studying various biological processes and identifying potential therapeutic targets.
RED antibody
The RED antibody is a monoclonal antibody that specifically targets erythropoietin (EPO). It is designed to neutralize the activity of EPO by inhibiting its endocytic uptake. This antibody has been extensively used in immunoassays to detect and quantify EPO levels in various biological samples. The RED antibody is highly specific and exhibits minimal cross-reactivity with other proteins or molecules. It is produced using state-of-the-art technology and undergoes rigorous quality control to ensure its effectiveness and reliability. In addition, the RED antibody is formulated with excipients that enhance its stability and shelf life. Whether you are conducting research in Life Sciences or developing therapeutic agents, the RED antibody can be a valuable tool for studying EPO-related processes, such as erythropoiesis or the interaction of EPO with human endothelial cells. Its use can also help elucidate the role of EPO in various physiological and pathological conditions. With its high affinity and neutralizing properties, the RED
TFE3 antibody
The TFE3 antibody is a monoclonal antibody that specifically targets CD33, an antigen expressed on the surface of certain cells. It belongs to the class of anti-CD33 antibodies and is widely used in life sciences research. The TFE3 antibody has been shown to bind to CD33 with high affinity, effectively blocking receptor binding and modulating downstream signaling pathways. This antibody can be used for various applications, including flow cytometry, immunohistochemistry, and western blotting. Additionally, the TFE3 antibody has been used in studies investigating autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. Its ability to neutralize TNF-α and inhibit the activation of immune cells makes it a valuable tool in immunology research. Furthermore, this antibody has shown potential therapeutic effects in preclinical models of cancer by targeting CD33-expressing tumor cells. With its versatility and wide range of applications, the TFE3 antibody is an essential tool for
HES1 antibody
The HES1 antibody is a highly activated monoclonal antibody used in Life Sciences research. It specifically targets and binds to HES1, a protein involved in various cellular processes. This antibody has been shown to inhibit the activity of interferon-gamma (IFN-γ), glutamate, and interleukin-6 (IL-6) signaling pathways. Additionally, it can be used for the visualization of actin filaments in cells due to its high specificity towards actin. The HES1 antibody has a high viscosity, making it ideal for applications that require long-term stability and minimal sample loss. Furthermore, this antibody exhibits cytotoxic effects on targeted cells, making it a valuable tool for studies involving cell viability and apoptosis.
MPP3 antibody
MPP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV
GJB2 antibody
GJB2 antibody was raised using the N terminal of GJB2 corresponding to a region with amino acids STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
TFF1 antibody
The TFF1 antibody is a highly specific monoclonal antibody that targets the glutamate receptor. It has cytotoxic properties and can effectively neutralize autoantibodies in the body. The TFF1 antibody is designed to specifically bind to reactive antibodies, preventing them from causing harm to healthy cells. Additionally, this antibody has been shown to inhibit the activity of β-catenin, a protein involved in cell adhesion and signaling pathways.
