Primary Antibodies

The KLK2 antibody is a monoclonal antibody that specifically targets the KLK2 protein in human serum. This antibody has been extensively studied and characterized using various techniques, such as molecular docking and polymerase chain reaction (PCR). It has shown high specificity and affinity for the KLK2 protein, making it an ideal tool for research in the field of Life Sciences.

The TYK2 antibody is a powerful tool used in the field of Life Sciences. It is a multidrug that targets the nuclear chemokine receptors and acts on actin filaments. This antibody has been extensively studied and has shown efficacy in various research areas.

Affinity purified Rabbit polyclonal SAFB1 antibody

MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR

Rabbit polyclonal Caspase 6 antibody (Ser257)

FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL

The SGSH antibody is a highly specialized monoclonal antibody used in Life Sciences for various applications. This antibody specifically targets and binds to cytotoxic substances, offering neutralizing effects. It has been extensively studied for its binding properties to proteins such as anti-CD20 and alpha-fetoprotein. The SGSH antibody has shown promising results in the detection and treatment of amyloid plaque, making it a potential medicament for neurodegenerative diseases. Its unique characteristics make it an essential tool in research laboratories and diagnostic settings. With its high specificity and affinity, this monoclonal antibody is widely recognized for its reliability and accuracy.

The CD5 antibody is a monoclonal antibody that targets CD20, a glycoprotein expressed on the surface of B cells. It is widely used in the field of life sciences for research purposes. The CD5 antibody acts as an inhibitor by binding to CD20 and preventing its interaction with other molecules, thus inhibiting B cell activation and proliferation. This antibody can be immobilized on various surfaces for use in assays or experiments. It has been shown to have chemokine-like properties and can induce apoptosis in certain cancer cell lines, such as MCF-7. Additionally, the CD5 antibody can be used in combination with recombinant proteins or other antibodies to create antibody-drug conjugates or for targeted therapy. Its versatility and specificity make it a valuable tool in the field of protein research and drug development.

Affinity purified Rabbit polyclonal PRPS1L1 antibody

Goat anti-human lambda chain (Fab'2) was raised in goat using human l (lambda) light chain as the immunogen.

The KLK6 antibody is an extracellular antibody that is primarily used in neuronal cultures for research purposes. This antibody specifically targets the phosphorylation site of KLK6, a protein that plays a crucial role in various biological processes within the Life Sciences field. KLK6 is known to interact with growth factors and synaptic proteins, and its activity has been linked to exocytosis and vesicular trafficking. By targeting KLK6, this polyclonal antibody can help researchers gain insights into the mechanisms of inhibitory neurotransmission and the regulation of protein isoforms. Additionally, it can be used to study the involvement of KLK6 in protein kinase signaling pathways.

Affinity purified Rabbit polyclonal ZFP 140 antibody

COL8A2 antibody was raised in rabbit using the C terminal of COL8A2 as the immunogen

The SERPINB13 antibody is a highly specialized colloidal antibody that belongs to the class of neurotrophic monoclonal antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets and binds to SERPINB13, a protein involved in regulating ferritin, phosphatase, glucagon, and growth factor levels. The SERPINB13 antibody has both acidic and neutralizing properties, making it suitable for a range of research purposes. Its high specificity and affinity ensure accurate detection and quantification of SERPINB13 in various biological samples. With its exceptional performance and reliability, this monoclonal antibody is an essential tool for scientists working in diverse research areas.

The HSF2 antibody is a biomolecule widely used in Life Sciences research. It plays a crucial role in various applications such as electrophoresis, neutralizing specific proteins or molecules, and measuring microvessel density. This antibody has shown promising results in inhibiting the activity of erythropoietin, a growth factor involved in red blood cell production. Additionally, it has been used as an immunosuppressant and is commonly employed in immunoassays to detect specific targets. The HSF2 antibody exhibits cytotoxic properties and can be utilized as a tool for targeted therapy. It is available as a monoclonal antibody and can be combined with other colloidal inhibitors for enhanced efficacy. Researchers also explore the potential of this antibody as a natriuretic agent due to its ability to regulate fluid balance within the body.

Affinity purified Rabbit polyclonal LOC283129 antibody

Affinity purified Rabbit polyclonal CLN2 antibody

HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD

WDSUB1 antibody was raised using the middle region of WDSUB1 corresponding to a region with amino acids KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS

FECH antibody was raised in Rabbit using Human FECH as the immunogen

The Caspase 7 antibody is a highly specialized nuclear receptor that plays a crucial role in apoptosis, the process of programmed cell death. This antibody specifically targets and binds to the HER2 protein, making it an effective anti-HER2 antibody. It belongs to the group of polyclonal antibodies, which are derived from multiple B-cell clones and can recognize different epitopes on the target protein.

Rabbit polyclonal eIF4E antibody for detection of the Phospho-Ser209 form of the eIF4E peptide.

The FMO2 antibody is a monoclonal antibody that has been developed for its potential use as a medicament in the field of Life Sciences. This antibody exhibits cytotoxic properties and has been shown to induce cell cytotoxicity in various studies. It specifically targets and binds to a growth factor known as phosphorylcholine, inhibiting its activity and preventing further cell growth.

Fascin antibody is a highly specific monoclonal antibody that targets fascin, a protein involved in cell migration and adhesion. It binds to histidine residues on the fascin molecule, inhibiting its function and preventing tumor metastasis. This antibody has been extensively studied in various research fields, including cancer biology and immunology. Fascin antibody can be used in experiments to detect fascin expression levels in human serum samples or tissue sections. Additionally, it has been shown to have cytotoxic effects on cancer cells and can be used as a therapeutic agent in cancer treatment. The use of this antibody has also been explored in autoimmune diseases, where autoantibodies targeting fascin have been identified. Overall, Fascin antibody is a valuable tool for researchers in the Life Sciences field who are studying cell migration, tumor metastasis, and autoimmunity.

The TFF1 antibody is a highly specific monoclonal antibody that targets the glutamate receptor. It has cytotoxic properties and can effectively neutralize autoantibodies in the body. The TFF1 antibody is designed to specifically bind to reactive antibodies, preventing them from causing harm to healthy cells. Additionally, this antibody has been shown to inhibit the activity of β-catenin, a protein involved in cell adhesion and signaling pathways.

Complement C9 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of complement C9. This antibody has been shown to have potent cytotoxic effects on cancer cells, making it a promising candidate for targeted cancer therapy. In addition, the colloidal nature of this antibody allows for easy administration and distribution throughout the body. Studies have also demonstrated its ability to inhibit β-catenin signaling, which plays a crucial role in tumor growth and metastasis. Furthermore, this antibody has shown potential in treating thrombocytopenia by blocking the activation of platelets. With its high specificity and low toxicity, complement C9 antibody holds great promise in the field of life sciences and may pave the way for new therapeutic approaches in various diseases.

The KRT19 antibody is a highly effective neutralizing agent used in Life Sciences. It is designed to target specific epitopes and bind to the desired antigens with high affinity. This antibody is produced using state-of-the-art technology and undergoes rigorous quality control measures to ensure its effectiveness.

AGPAT6 antibody was raised in Rabbit using Human AGPAT6 as the immunogen

CXCL12 antibody was raised in rabbit using the middle region of CXCL12 as the immunogen

Rabbit polyclonal MKNK1 antibody

LOH12CR1 antibody was raised in Rabbit using Human LOH12CR1 as the immunogen

Rabbit polyclonal CREB1 antibody (Ser133)

Rabbit polyclonal SCYE1 antibody

The STAT1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to the STAT1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry.

Affinity purified Rabbit polyclonal Calpain 5 antibody

The CYP2J2 antibody is a highly specialized monoclonal antibody that targets β-catenin, a key protein involved in cell adhesion and signaling pathways. This antibody specifically inhibits the activation of chemokine receptors, which are important for immune cell recruitment and inflammation. It has been extensively studied as a potential therapeutic target for various diseases, including cancer and cardiovascular disorders.

The TIMP2 antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing molecule. It is a neutralizing antibody that has been extensively studied in the field of Life Sciences. This antibody has shown great potential in inhibiting endothelial growth and angiogenesis, making it a valuable tool for research in the field of cancer biology and tumor development. Additionally, the TIMP2 antibody has been used to detect alpha-fetoprotein levels in human serum, making it an important tool for diagnostic purposes. With its high specificity and affinity for its target molecule, this antibody offers great promise for further advancements in the understanding and treatment of various diseases.

ZFYVE27 antibody was raised using the C terminal of ZFYVE27 corresponding to a region with amino acids TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC

MBD5 antibody was raised in Rabbit using Human MBD5 as the immunogen

MMACHC antibody was raised in rabbit using the C terminal of MMACHC as the immunogen

BAG5 antibody was raised in rabbit using the C terminal of BAG5 as the immunogen

Rabbit polyclonal Tau antibody (Ser422)

CKMT1A antibody was raised in Rabbit using Human CKMT1A as the immunogen

Affinity purified Rabbit polyclonal PODXL2 antibody

Rabbit polyclonal AP2S1 antibody (HRP)