Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
TOPK antibody
The TOPK antibody is a monoclonal antibody that targets the T-LAK cell-originated protein kinase (TOPK). This antibody is widely used in Life Sciences research to study the role of TOPK in various cellular processes. It has been shown to interact with chemokines, interferons, and epidermal growth factors, suggesting its involvement in immune responses and cell signaling pathways. The TOPK antibody is highly specific and can be used for applications such as immunofluorescence, Western blotting, and immunoprecipitation. Its binding to TOPK effectively inhibits its kinase activity, making it a valuable tool for studying the function of this family kinase. The TOPK antibody is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their experimental needs. Its high affinity for TOPK ensures reliable and accurate results in experiments. With its neutralizing properties, this antibody can help elucidate the molecular mechanisms underlying various diseases and aid in the
PMVK antibody
The PMVK antibody is a highly specialized monoclonal antibody that acts as a family kinase inhibitor. It is colloidal in nature and has been extensively studied for its potential to inhibit endothelial growth. This antibody specifically targets the alpha-fetoprotein, which plays a crucial role in tumor development and progression.
FASL antibody
The FASL antibody is a powerful tool in the field of Life Sciences. It is an amino group-containing antibody that specifically targets the HER2 protein, which is known to be involved in various cellular processes. One of the key functions of the FASL antibody is its ability to induce apoptosis through the FAS-mediated pathway. This means that it can trigger programmed cell death in cells that express high levels of HER2, making it a valuable tool for researchers studying cancer and other diseases.
Androgen Receptor antibody
The Androgen Receptor antibody is a neutralizing monoclonal antibody that targets the androgen receptor, a protein involved in the regulation of male sexual development and function. This antibody has been shown to inhibit the activity of the androgen receptor, leading to decreased growth factor signaling and reduced expression of genes regulated by androgens.
Purity:Min. 95%CD90.2 antibody (Spectral Red)
CD90.2 antibody (Spectral Red) was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.
Purity:Min. 95%Ref: 3D-CLA1552
Discontinued productTMPRSS4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp technique, it has been proven to effectively inhibit bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture. With its unique mechanisms of action and potent properties, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is
ZNF488 antibody
ZNF488 antibody was raised in rabbit using the C terminal of ZNF488 as the immunogen
Purity:Min. 95%Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.
Purity:Min. 95%CCL5 antibody
The CCL5 antibody is a highly specialized polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the CCL5 protein, a growth factor involved in angiogenesis and inflammation. This antibody can be used in various experimental techniques, such as immunohistochemistry or Western blotting, to study the role of CCL5 in different biological processes. It has been extensively tested and validated for its specificity and effectiveness in binding to the target molecule. Researchers can rely on this high-quality antibody to accurately detect and quantify CCL5 levels in samples, providing valuable insights into its function and potential therapeutic applications.
LOC642097 antibody
LOC642097 antibody was raised using the N terminal Of Loc642097 corresponding to a region with amino acids MSDAHLGEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRAL
CA 50 antibody
CA 50 antibody was raised in mouse using human CA50 antigen as the immunogen.
Purity:Min. 95%MPT64 antibody
The MPT64 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain viruses and antibodies. It is commonly used in the field of Life Sciences for various applications. This antibody has been shown to have a strong affinity for interferon-gamma (IFN-gamma), a potent growth factor involved in immune response regulation. Additionally, it has the ability to bind to nuclear proteins and inhibit polymerase chain reactions (PCR). The MPT64 antibody can also be used to detect virus surface antigens in human serum samples, making it a valuable tool in diagnostic testing. With its electrode-activated properties, this antibody ensures accurate and reliable results in research and clinical settings.
Angiotensinogen antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known for its potent bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth and prevents transcription and replication. This active compound has been extensively studied using the patch-clamp technique on human erythrocytes. Metabolized through various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it exhibits high efficacy against Mycobacterium tuberculosis strains. Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis infection.
Aldolase antibody
The Aldolase antibody is a highly specialized protein used in Life Sciences research. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody targets various proteins, including caspase-9, endonuclease, and β-catenin, among others.
MMD2 antibody
MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL
CD45 antibody (FITC)
CD45 antibody (FITC) was raised in mouse using chicken CD45 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molRabbit anti Goat IgG (H + L) (HRP)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Purity:Min. 95%PLD3 antibody
PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
Purity:Min. 95%GPR37 antibody
GPR37 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%mGluR1 alpha antibody
mGluR1 alpha antibody was raised in rabbit using a synthetic peptide comprising internal residues of the human GluR1 alpha protein as the immunogen.Purity:Min. 95%SOCS1 antibody
SOCS1 antibody was raised using the N terminal of SOCS1 corresponding to a region with amino acids RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA
FABP antibody
FABP antibody is a growth factor that has been modified with colloidal acid to enhance its neutralizing properties. It specifically targets lipoprotein lipase and inhibits its activity, making it an effective tool in studying the role of lipoproteins in various biological processes. This antibody has undergone glycosylation, which improves its stability and bioavailability. FABP antibody is commonly used in Life Sciences research, particularly in studies involving interferon and monoclonal antibodies. It can be immobilized on cellulose for purification purposes or used as a detection tool in assays. Whether you need a monoclonal or polyclonal antibody, FABP antibody is a valuable tool for your research needs.
