Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
CCL2 antibody
The CCL2 antibody is a monoclonal antibody that specifically targets the chemokine CCL2. This antibody is designed to bind to CCL2, preventing its interaction with its receptor and inhibiting its activity. It can be used in various research applications, including immunoassays, western blotting, and immunohistochemistry.SDHB antibody
The SDHB antibody is a highly effective neutralizing monoclonal antibody that targets a specific growth factor. It is colloidal in nature and has been extensively studied for its therapeutic potential. This antibody binds to a specific antigen, preventing it from interacting with its receptor and inhibiting the downstream signaling pathway. The SDHB antibody has also been shown to have neurotrophic and neuroprotective effects, making it a promising candidate for the treatment of neurological disorders. Additionally, this antibody has been used in research settings to detect the presence of certain proteins, such as the circumsporozoite protein. Its high specificity and sensitivity make it a valuable tool for various applications in both academic and industrial settings.
Villin antibody
The Villin antibody is a highly effective and versatile tool in the field of biomedical research. This colloidal antibody specifically targets β-catenin, a key regulator of cell growth and development. By neutralizing β-catenin activity, this monoclonal antibody can inhibit the signaling pathways associated with epidermal growth factor (EGF) and interleukins, which play crucial roles in cellular processes such as proliferation and differentiation.
Granzyme B antibody (PE)
Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.
SIRT5 antibody
SIRT5 antibody was raised using the middle region of SIRT5 corresponding to a region with amino acids PICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLD
IL13RA2 antibody
IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL
AQP8 antibody
The AQP8 antibody is a diagnostic agent used in Life Sciences for the detection of protein-protein interactions. It is reactive towards sorafenib and has been shown to specifically bind to chemokine receptors. This monoclonal antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The AQP8 antibody is also capable of detecting autoantibodies and can be used to study the role of specific proteins in disease pathology. It recognizes specific epitopes on AQP8, which is an aquaporin protein involved in the transport of water and glycerol across cell membranes. With its high specificity and sensitivity, this polyclonal antibody is an essential tool for researchers in the field of Life Sciences.
CLP1 antibody
The CLP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is an anti-HER2 antibody that specifically targets the epidermal growth factor receptor HER2, which is overexpressed in certain types of cancer cells. The CLP1 antibody has been extensively studied and shown to have cytotoxic effects on cancer cells, making it a promising candidate for targeted therapies.
NQO1 antibody
The NQO1 antibody is a highly specific monoclonal antibody that targets the alpha-fetoprotein. It is widely used in Life Sciences research for various applications. This antibody binds to the vasoactive intestinal peptide (VIP) and can be used as an electrode for studying VIP receptors. Additionally, it has been shown to have colony-stimulating factor activity and can activate colony-stimulating cells. The NQO1 antibody also exhibits acidic phosphatase activity and is commonly used in assays to detect this enzyme in human serum samples. Furthermore, it has been found to modulate the production of interferon-gamma (IFN-gamma), a key cytokine involved in immune responses. With its wide range of applications, the NQO1 antibody is an essential tool for researchers in the field of Life Sciences.
Complement C9 antibody
Complement C9 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of complement C9. This antibody has been shown to have potent cytotoxic effects on cancer cells, making it a promising candidate for targeted cancer therapy. In addition, the colloidal nature of this antibody allows for easy administration and distribution throughout the body. Studies have also demonstrated its ability to inhibit β-catenin signaling, which plays a crucial role in tumor growth and metastasis. Furthermore, this antibody has shown potential in treating thrombocytopenia by blocking the activation of platelets. With its high specificity and low toxicity, complement C9 antibody holds great promise in the field of life sciences and may pave the way for new therapeutic approaches in various diseases.
CD19 antibody (Spectral Red)
CD19 antibody (Spectral Red) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molRANKL antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive human activity studies using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains, such as ESX-1 secretion system protein, effectively inhibiting cell growth in culture.
BHMT antibody
The BHMT antibody is a monoclonal antibody that specifically targets the ubiquitin protein. It has been extensively studied for its role in various biological processes, including the regulation of protein kinase activity and endothelial growth. This antibody is widely used in research assays and has proven to be a valuable tool in the field of Life Sciences.
Streptococcus Group B antibody (biotin)
Streptococcus group B antibody (biotin) was raised in rabbit using group B Streptococci as the immunogen.CDH13 antibody
The CDH13 antibody is a glycoprotein that specifically targets autoantibodies. It is a monoclonal antibody that contains a cycloalkyl group and has been shown to have cytotoxic effects. This antibody can be used in various applications, including immunohistochemistry, flow cytometry, and Western blotting. The CDH13 antibody has been used in research studies to investigate the role of CDH13 in different biological processes, such as cell adhesion and migration. It has also been used in combination with other antibodies, such as anti-CD33 antibody or sorafenib, to enhance its therapeutic potential. The CDH13 antibody has shown promising results in preclinical studies, demonstrating its ability to induce hemolysis and necrosis factor-related apoptosis-inducing effects on target cells. With its wide range of applications and potential therapeutic benefits, the CDH13 antibody is an essential tool for researchers in the field of Life Sciences.
RHEB antibody
The RHEB antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is used to detect and target RHEB, a protein involved in various cellular processes. This antibody has been extensively studied for its ability to inhibit the activity of RHEB, making it a valuable tool for research and therapeutic applications.
Donkey anti Guinea Pig IgG (H + L) (HRP)
Donkey anti-guinea pig IgG (H + L) (HRP) was raised in donkey using guinea pig IgG (H & L) as the immunogen.
BHMT antibody
The BHMT antibody is a monoclonal antibody that targets the cation channel inhibitors. It is used to detect autoantibodies against octanoyltransferase, which is an enzyme involved in the metabolism of carnitine. BHMT antibody can be used as part of diagnostic tests to identify individuals with deficiencies in this enzyme or those who may benefit from targeted therapies. This antibody is also commonly used in research settings to study the role of cation channels and methyl transferases in various diseases and conditions. With its high specificity and sensitivity, the BHMT antibody is a valuable tool for scientists and healthcare professionals alike.
Endostatin antibody
Endostatin antibody was raised in Mouse using recombinant endostatin as the immunogen.Purity:≥85% By Sds-PagePAOX antibody
PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids GGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLAAEYGLLGEKELSQENQ
CD30 antibody (biotin)
CD30 antibody (biotin) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.
Purity:Min. 95%Molecular weight:0 g/mol
