Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
DYSF antibody
DYSF antibody was raised using a synthetic peptide corresponding to a region with amino acids DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNEPurity:Min. 95%HGF antibody (biotin)
HGF antibody (biotin) was raised in goat using S. frugiperda insect ovarian cell line Sf 21-derived recombinant human HGF as the immunogen.Collagen Type IV alpha 3 antibody
Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLPurity:Min. 95%HIV1 gp120 antibody
HIV1 gp120 antibody was raised in rabbit using HIV-1 gp120 as the immunogen.Purity:Min. 95%GPR20 antibody
GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%GOLM1 antibody
GOLM1 antibody was raised using the N terminal of GOLM1 corresponding to a region with amino acids RSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSPurity:Min. 95%IL17F antibody
IL17F antibody was raised in rabbit using highly pure recombinant human IL-17F as the immunogen.Purity:Min. 95%MLXIPL antibody
MLXIPL antibody was raised in rabbit using the N terminal of MLXIPL as the immunogenPurity:Min. 95%PDE3B antibody
PDE3B antibody was raised using the middle region of PDE3B corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNPurity:Min. 95%PPAR alpha antibody
PPAR Alpha antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) V D T E S P I C P L S P L E A D D(18) C of mouse PPAR alpha.Purity:Min. 95%HER2 antibody
The HER2 antibody, also known as trastuzumab, is a highly effective cytotoxic agent used in the treatment of various cancers. This monoclonal antibody specifically targets the HER2 receptor, a glycoprotein that plays a crucial role in cell growth and division. By binding to the HER2 receptor, trastuzumab inhibits its activity and prevents the growth and proliferation of cancer cells.Purity:Min. 95%Goat anti Human IgM (mu chain)
This antibody reacts with heavy chains on human IgM (mu chain).Purity:Min. 95%IL6 antibody
IL6 antibody was raised in goat using highly pure recombinant human IL-6 as the immunogen.
TMCC1 antibody
TMCC1 antibody was raised using the middle region of TMCC1 corresponding to a region with amino acids YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK
Purity:Min. 95%PF4 antibody
PF4 antibody was raised in sheep using Platelet Factor 4 purified from human platelet releasate as the immunogen.Purity:Min. 95%Glycoprotein Ib antibody
Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Purity:Min. 95%Chicken RBC antibody
Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.
Purity:Min. 95%Goat anti Human IgG (H + L)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.
Purity:Min. 95%HGF antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
SOCS1 antibody
SOCS1 antibody was raised using the N terminal of SOCS1 corresponding to a region with amino acids RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA
FABP antibody
FABP antibody is a growth factor that has been modified with colloidal acid to enhance its neutralizing properties. It specifically targets lipoprotein lipase and inhibits its activity, making it an effective tool in studying the role of lipoproteins in various biological processes. This antibody has undergone glycosylation, which improves its stability and bioavailability. FABP antibody is commonly used in Life Sciences research, particularly in studies involving interferon and monoclonal antibodies. It can be immobilized on cellulose for purification purposes or used as a detection tool in assays. Whether you need a monoclonal or polyclonal antibody, FABP antibody is a valuable tool for your research needs.
ZNF488 antibody
ZNF488 antibody was raised in rabbit using the C terminal of ZNF488 as the immunogen
Purity:Min. 95%Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.
Purity:Min. 95%alpha 2 Antiplasmin antibody
Alpha 2 antiplasmin antibody was raised in mouse using purified alpha-2 antiplasmin as the immunogen.Murine Anti-HIV-1 p24 monoclonal Antibody
Please enquire for more information about Murine Anti-HIV-1 p24 monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Epsilon Tubulin 1 antibody
Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG
Purity:Min. 95%CCNA2 antibody
CCNA2 antibody was raised in rabbit using the C terminal of CCNA2 as the immunogenPurity:Min. 95%Goat anti Human IgA (alpha chain) (FITC)
This antibody reacts with heavy chains on human IgA (alpha chain) and.
IGF-1R antibody
The IGF-1R antibody is a powerful tool in the field of Life Sciences. It specifically targets the insulin-like growth factor-1 receptor, an important protein involved in cell growth and development. This antibody can be used in various research applications, including immunofluorescence, Western blotting, and immunohistochemistry.
Purity:Min. 95%CD30 antibody (biotin)
CD30 antibody (biotin) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.
Purity:Min. 95%GAA antibody
GAA antibody was raised using the N terminal of GAA corresponding to a region with amino acids FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL
Purity:Min. 95%Rabbit anti Whole Bovine serum antibody (IgG fraction)
Whole bovine serum antibody (IgG fraction) was raised in rabbit using bovine serum as the immunogen.Purity:Min. 95%SLC5A11 antibody
SLC5A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGGMEGLKEKYFLALASNRSENSSCGLPREDAFHIFRDPLTSDLPWPGVL
Purity:Min. 95%SHP2 antibody
The SHP2 antibody is a highly specialized antibody that targets specific molecules in the body. It has been extensively studied and proven to be effective in various applications. This antibody has the ability to bind to collagen, erythropoietin, TNF-related apoptosis-inducing ligand (TRAIL), autoantibodies, and disulfide bonds. It has also been shown to react with human serum proteins such as alpha-fetoprotein.
Purity:Min. 95%FAK antibody
The FAK antibody is a powerful tool in the field of Life Sciences. It is an antiviral antibody that specifically targets and neutralizes a cell antigen known as focal adhesion kinase (FAK). FAK is a key regulator of cell growth, migration, and survival, making it an important target for research and therapeutic applications.
Chicken anti Rabbit IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%Lipocalin 12 antibody
Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG
Purity:Min. 95%SET antibody
SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Purity:Min. 95%
