Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
Goat anti Bovine IgG (H + L) (FITC)
Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&L) as the immunogen.
Purity:Min. 95%Tetraspanin 32 antibody
Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD
CD107b antibody (FITC)
CD107b antibody (FITC) was raised in rat using glycoproteins purified from BALB/c mouse embryo 3T3 cell line as the immunogen.
Purity:Min. 95%Helicobacter pylori antibody (CagA protein)
Mouse monoclonal CagA protein antibody (Helicobacter pylori)IFI44L antibody
IFI44L antibody was raised using the N terminal of IFI44L corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
IL6 antibody
IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various immune responses. IL-6 plays a crucial role in inflammation, autoimmune disorders, and cancer progression. The IL6 antibody binds to IL-6, neutralizing its activity and preventing it from binding to its receptors.
LDB1 antibody
The LDB1 antibody is a powerful tool used in the field of life sciences. It is a polyclonal antibody that specifically targets the LDB1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in applications such as immunohistochemistry, Western blotting, and flow cytometry.
AFP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.TFE3 antibody
TFE3 antibody is a highly specific antibody that targets the TFE3 protein, which is involved in regulating gene expression. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. It recognizes the antigen with high affinity and specificity, making it an essential tool for researchers in the Life Sciences field.
Purity:Min. 95%SLC18A2 antibody
The SLC18A2 antibody is a monoclonal antibody that specifically targets the protein encoded by the SLC18A2 gene. This gene encodes a glycoprotein that functions as a vesicular monoamine transporter, responsible for transporting neurotransmitters such as dopamine, norepinephrine, and serotonin into synaptic vesicles. The SLC18A2 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.ROCK2 antibody
The ROCK2 antibody is a protein that has neutralizing properties against collagen. It belongs to the class of polyclonal antibodies and is used in Life Sciences research. This antibody specifically targets ROCK2, which stands for Rho-associated coiled-coil containing protein kinase 2. ROCK2 is involved in various cellular processes, including cell proliferation, migration, and contraction. The ROCK2 antibody can be used for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISAs). It is available in both monoclonal and polyclonal forms. The antibody can be immobilized on chromatographic resins or used for protein-protein interaction studies. Additionally, it can be used to study the role of ROCK2 in hepatocyte growth factor signaling pathways or to investigate its binding partners such as angptl3 or growth factor binding proteins.
Chlamydia trachomatis antibody
Chlamydia trachomatis antibody was raised in mouse using Chlamydia trachomatis LPS as the immunogen.Treponema pallidum antibody
Treponema pallidum antibody was raised in rabbit using highly purified Treponema pallidum as the immunogen.
Purity:Min. 95%IL2Ra antibody
IL2Ra antibody was raised in mouse using recombinant human soluble IL-2 Receptor alpha as the immunogen.
WDR4 antibody
WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
RGS13 antibody
RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK
DUSP5 antibody
DUSP5 antibody was raised in rabbit using the middle region of DUSP5 as the immunogen
Purity:Min. 95%CD4 antibody (FITC)
CD4 antibody (FITC) was raised in rat using cloned murine CTL line V4 as the immunogen.
ERG antibody
The ERG antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the ERG protein, which plays a critical role in cellular processes such as collagen production and TGF-beta1 signaling. This antibody can be used for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The ERG antibody is designed to provide accurate and reliable results, ensuring the highest level of specificity and sensitivity. It can be used with various enzyme substrates and detection systems to achieve optimal performance. Whether you are studying cell signaling pathways or investigating disease mechanisms, the ERG antibody is an invaluable tool for your research needs. With its exceptional quality and performance, this antibody will help advance your scientific discoveries in the field of Life Sciences.
BAAT antibody
BAAT antibody was raised using the N terminal of BAAT corresponding to a region with amino acids IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR
AADAT antibody
AADAT antibody was raised using the middle region of AADAT corresponding to a region with amino acids EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI
Aldolase antibody
The Aldolase antibody is a highly specialized protein used in Life Sciences research. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody targets various proteins, including caspase-9, endonuclease, and β-catenin, among others.
MMD2 antibody
MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL
D-dimer Mouse Monoclonal Antibody
This product is a protein A purified mouse monoclonal antibody with clones of the immunoglobulin subclasses: IgG1 and IgG2a available. These clones recognise human D-Dimer and high molecular weight fibrin degradation products and no cross-reactions is observed with fibrinogen and D-monomer. A potential application of this product is for coating to latex particles for latex enhanced immunoturbidimetric applications. It can further be used in ELISA and immunofluorescent assays.
Human D-dimer, a soluble fibrin degradation product recognised by this antibody product, can be used as a marker for clinical conditions where the process of coagulation and fibrinolysis have been activated. For example it can be used in the diagnosis of venous thromboembolism and intravascular coagulation. The formation of human D-dimer occurs when fibrinogen is converted to fibrin monomers when the enzyme thrombin cleaves fibrinopeptides at the N-terminal domain of fibrinogen. These monomers aggregate when interacting with another enzyme: activated factor XIII (factor XIIIa) forming a cross-linked fibrin polymer, also known as a fibrin clot. A final enzyme, plasmin, degrades this fibrin clot, resulting in D-dimer. It is important to note that when applying this product clinically, levels of D-dimer can be influenced by human factors such as age, pregnancy and cancer.Chikungunya Virus Envelope 1 & 2 Antigen Mouse Monoclonal Antibody
A Mouse Monoclonal Antibody complementary to recombinant Chikungunya envelope 1 (E1) and 2 (E2) proteins, which is available as the immunoglobulin subclass IgG1. The product has been purified by ion exchange chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.
Transmitted by mosquito vectors, Chikungunya is a positive-stranded RNA, alpha virus infecting human musculoskeletal tissues. The two glycoproteins E1 and E2 of the Chikungunya virus, to which this Mab is complementary, are responsible for viral entry into host cells and both contain a transmembrane domain. Furthermore E2 has the three globular domains A, B and C which are linked by a β-ribbon connector region. While E2 is essential for mediating viral attachment, E1’s β-sheet structure and class II viral glycoproteins: DI, DII and DIII domains enable the virus to fuse with the host’s membrane. This primarily occurs through the insertion of the DII domain’s fusion loop into the host’s cell membrane.
Together E1 and E2 form a viral spike protein which when binding with high affinity to host alphavirus receptors such as Mxra8, allow this receptor to be inserted into E1 and E2. This results in Mxra8 contact between E2’s A and B domains and E1’s fusion loop. Neutralising antibodies can target these domains, in particular A and B domains within E2, hence preventing viral attachment to host cells. Consequently this antibody could be used to investigate possible treatments to combat Chikungunya virus. Another potential application of this product could be used in antibody and antigen interaction dependent assays to detect the presence of the Chikungunya virus.Purity:>90% By Sds-Page.
