Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
CD19 antibody (PE-CY7)
CD19 antibody (PE) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.
Purity:Min. 95%IFN gamma antibody
IFN gamma antibody was raised in mouse using highly pure recombinant human IFN-gamma as the immunogen.IKB alpha antibody
The IKB alpha antibody is a highly specialized monoclonal antibody that targets and binds to the inhibitor of kappa B alpha (IKBα) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It is widely used in research laboratories for the detection and analysis of IKBα in different biological samples.
Purity:Min. 95%PARD6A antibody
PARD6A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
HDAC4 antibody
The HDAC4 antibody is a highly specific antibody that targets the histone deacetylase 4 (HDAC4) protein. HDAC4 is involved in the regulation of gene expression and plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. This antibody can be used for research purposes in the field of Life Sciences to study the function and localization of HDAC4 in different cell types.
Purity:Min. 95%GPR20 antibody
GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%MLXIPL antibody
MLXIPL antibody was raised in rabbit using the N terminal of MLXIPL as the immunogenPurity:Min. 95%PARVB antibody
PARVB antibody was raised using the C terminal of PARVB corresponding to a region with amino acids HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVEPurity:Min. 95%PDE3A antibody
PDE3A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%ZBTB26 antibody
ZBTB26 antibody was raised in rabbit using the middle region of ZBTB26 as the immunogen
Purity:Min. 95%HER2 antibody
The HER2 antibody, also known as trastuzumab, is a highly effective cytotoxic agent used in the treatment of various cancers. This monoclonal antibody specifically targets the HER2 receptor, a glycoprotein that plays a crucial role in cell growth and division. By binding to the HER2 receptor, trastuzumab inhibits its activity and prevents the growth and proliferation of cancer cells.Purity:Min. 95%Goat anti Human IgM (mu chain)
This antibody reacts with heavy chains on human IgM (mu chain).Purity:Min. 95%Keratin K1 antibody
Keratin K1 antibody was raised in Guinea Pig using synthetic peptide of human keratin K1 coupled to KLH as the immunogen.
Purity:Min. 95%PF4 antibody
PF4 antibody was raised in sheep using Platelet Factor 4 purified from human platelet releasate as the immunogen.Purity:Min. 95%Goat anti Human IgG Fc
Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.
Chicken RBC antibody
Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.
Purity:Min. 95%Goat anti Human IgG (H + L)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.
Purity:Min. 95%RAB5a antibody
RAB5a antibody was raised in mouse using recombinant human Rab5a (1-215aa) purified from E. coli as the immunogen.
Rag1 antibody
Rag1 antibody was raised in rabbit using the C terminal of Rag1 as the immunogen
Purity:Min. 95%Plasminogen antibody
The Plasminogen antibody is a growth factor that plays a crucial role in various biological processes. It contains acid residues that enable it to bind to fibrinogen and exert its proteolytic activity. This Polyclonal Antibody can specifically recognize and bind to the Plasminogen antigen, leading to the formation of antigen-antibody complexes. These complexes have been shown to have various biological effects, including the regulation of hepatocyte growth and the modulation of microvessel density.
Purity:Min. 95%Cytokeratin 10 antibody
Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.
TCP10 antibody
TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH
PLD3 antibody
PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
Purity:Min. 95%TRPM5 antibody
TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV
Purity:Min. 95%Chicken anti Goat IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.
Purity:Min. 95%DTL antibody
DTL antibody was raised using a synthetic peptide corresponding to a region with amino acids VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV
ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Purity:Min. 95%SERPINE1 antibody
SERPINE1 antibody was raised using the C terminal of SERPINE1 corresponding to a region with amino acids VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMPurity:Min. 95%GSG1 antibody
GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE
Purity:Min. 95%MAOA antibody
The MAOA antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of the MAOA enzyme. This enzyme plays a crucial role in various physiological processes, including the regulation of lipoprotein lipase, interleukin-6, and adipose tissue metabolism. By inhibiting MAOA activity, this antibody has been shown to have significant effects on cellular processes such as fas-mediated apoptosis, phosphatase activity, actin filament organization, and erythropoietin signaling.
WAS antibody
The WAS antibody is a polyclonal antibody used in life sciences research. It specifically targets the antigen-binding domain of the Wiskott-Aldrich syndrome (WAS) protein. This antibody is commonly used to detect protein carbonyls and has been extensively validated for use in various experimental settings. The WAS antibody is available as both monoclonal and polyclonal preparations, with the polyclonal form being particularly useful for neutralizing experiments. It can be used in a range of applications, including Western blotting, immunohistochemistry, and immunofluorescence. Additionally, this antibody has shown potential in studies involving polypeptide expression, anti-dnp antibodies, growth factors, caspase-9 signaling pathways, cholinergic systems, and bioassays. Researchers can rely on the high quality and specificity of the WAS antibody to advance their scientific investigations.
CD4 antibody (Allophycocyanin-CY7)
CD4 antibody (Allophycocyanin) was raised in mouse using human CD4 as the immunoge.
Purity:Min. 95%HDAC5 antibody
The HDAC5 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets atypical hemolytic autoantibodies. This antibody has neutralizing properties, meaning it can inhibit the activity of these autoantibodies, preventing them from causing damage to red blood cells. The HDAC5 antibody is produced using state-of-the-art techniques and has been extensively tested for its efficacy and specificity.
Purity:Min. 95%Protein C antibody
Protein C antibody was raised in goat using human Protein C purified from plasma as the immunogen.Purity:Min. 95%Beta Tubulin 2A antibody
Beta Tubulin 2A antibody was raised using the middle region of TUBB2A corresponding to a region with amino acids AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC
SCRT2 antibody
SCRT2 antibody was raised in rabbit using the middle region of SCRT2 as the immunogenPurity:Min. 95%Rabbit anti Guinea Pig IgG (H + L) (rhodamine)
Rabbit anti-guinea pig IgG (H+L) (Rhodamine) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.
Purity:Min. 95%
