Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
APE1 antibody
The APE1 antibody is a highly specific monoclonal antibody that targets endoplasmic reticulum aminopeptidase 1 (APE1). It is used in Life Sciences research to study the role of APE1 in various cellular processes. This antibody has been shown to neutralize the activity of APE1, which is involved in DNA repair and redox regulation. It can be used for immunoprecipitation, Western blotting, and immunofluorescence experiments. The APE1 antibody has been validated using mass spectrometric methods and has been shown to specifically recognize APE1 in nuclear extracts. It can also be immobilized on an electrode for use in electrochemical assays. With its high specificity and versatility, the APE1 antibody is an essential tool for researchers studying growth factors, signal transduction pathways, and DNA repair mechanisms.
Netrin 1 antibody
Netrin 1 antibody is a growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets netrin 1, a protein involved in cell migration and axon guidance. This antibody can be used for various applications, including research in the life sciences field.
DDX48 antibody
DDX48 antibody was raised using a synthetic peptide corresponding to a region with amino acids QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV
Goat anti Mouse IgM (Fab'2) (HRP)
Goat anti-mouse IgM (Fab'2) (HRP) was raised in goat using murine IgM mu heavy chain as the immunogen.Purity:Min. 95%GTPBP2 antibody
GTPBP2 antibody was raised using the C terminal of GTPBP2 corresponding to a region with amino acids VLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFL
Florfenicol Amine antibody
Florfenicol Amine antibody is a powerful tool for detecting and studying the expression of forskolin in various samples. It is a polyclonal antibody that specifically binds to forskolin, a potent activator of adenylate cyclase. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and ELISA.Purity:Min. 95%Complement C3 antibody
The Complement C3 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications. This antibody specifically targets the complement component C3, which is an essential protein involved in the immune response. The Complement C3 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. These antibodies are designed to recognize and bind to different epitopes of the C3 protein, ensuring accurate and reliable results. In addition to its role in the immune system, the Complement C3 antibody has been shown to have antiangiogenic properties. It inhibits endothelial cell growth and angiogenesis, making it a valuable tool for studying these processes. The Complement C3 antibody is widely used in various fields of life sciences research, including immunology, molecular biology, and biochemistry. It can be used in techniques such as Western blotting, immunohistochemistry, flow
SLN antibody
The SLN antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and detect arginase, an enzyme involved in the metabolism of arginine. This antibody recognizes specific glycan structures on the arginase protein, allowing for accurate detection and quantification.
Flag Tag antibody
The Flag Tag antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. It is designed to specifically target and bind to the Flag epitope, which is a small peptide sequence commonly added to proteins for detection and purification purposes. This antibody has been extensively validated for use in various applications such as immunoassays, Western blotting, immunofluorescence, and flow cytometry. One of the key advantages of the Flag Tag antibody is its high affinity and specificity towards the Flag epitope. This ensures reliable and accurate detection of proteins carrying this tag. Additionally, the antibody exhibits minimal cross-reactivity with other commonly used tags, making it an ideal choice for researchers working with multiple protein expression systems. In addition to its exceptional performance in protein detection, the Flag Tag antibody also offers excellent stability and reproducibility. It can withstand harsh experimental conditions such as high temperatures or denaturing agents without compromising its binding efficiency. This makes it suitable for a wide range
HIV1 gp41 antibody
HIV1 gp41 antibody was raised in goat using recombinant ectodomain of gp41 (glycosylated) as the immunogen.Purity:Min. 95%DKFZP761C169 antibody
DKFZP761C169 antibody was raised using the N terminal Of Dkfzp761C169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP
ApoE antibody
Apolipoprotein E antibody was raised in mouse using human apolipoprotein E as the immunogen.
Goat anti Human IgG (Fab'2) (HRP)
Goat anti-human IgG (Fab'2) (HRP) was raised in goat using human IgG F(ab’)2 fragment as the immunogen.Purity:Min. 95%Cat RBC antibody (FITC)
Feline RBC antibody (FITC) was raised in rabbit using feline erythrocytes as the immunogen.AK2 antibody
AK2 antibody was raised using the N terminal of AK2 corresponding to a region with amino acids MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML
MCM6 antibody
The MCM6 antibody is a specific antibody that targets the c-myc protein. It is commonly used in research and life sciences to study various cellular processes. This monoclonal antibody has been shown to effectively detect and bind to the c-myc protein, allowing for its visualization and analysis. The MCM6 antibody can be used in various immunological techniques such as Western blotting, immunohistochemistry, and immunofluorescence. It has also been used to study microvessel density and the expression of growth factors like epidermal growth factor (EGF) and transforming growth factor-beta (TGF-beta). Additionally, this monoclonal antibody has been utilized in cancer research, particularly in studies involving the plasminogen receptor and its role in tumor progression. With its high specificity and reliability, the MCM6 antibody is an essential tool for researchers aiming to explore the functions of c-myc protein and related pathways.
Monensin antibody
The Monensin antibody is a highly specialized antibody used in Life Sciences research. It is an acidic polyclonal antibody that specifically targets and binds to Monensin, a compound known for its cytotoxic and inhibitory effects on various cellular processes. This antibody has been extensively studied and validated for its specificity and sensitivity in detecting Monensin in biological samples.Purity:Min. 95%
