Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
Pneumolysin antibody
Pneumolysin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets pneumolysin, a protein produced by Streptococcus pneumoniae, which is responsible for causing pneumonia and other respiratory infections. This antibody has been shown to neutralize the activity of pneumolysin, preventing its damaging effects on host cells. Pneumolysin antibody can be used in various applications such as immunohistochemistry, ELISA, and Western blotting to study the role of pneumolysin in disease progression and to develop new therapeutic strategies. With its high specificity and affinity for pneumolysin, this antibody is a valuable tool for researchers in the field of infectious diseases.
Purity:Min. 95%SLC5A11 antibody
SLC5A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGGMEGLKEKYFLALASNRSENSSCGLPREDAFHIFRDPLTSDLPWPGVL
Purity:Min. 95%P-Selectin antibody
The P-Selectin antibody is an amide-based monoclonal antibody that specifically targets the glycoprotein P-Selectin. This medicament is widely used in the field of Life Sciences for various biochemical studies and research purposes. The P-Selectin antibody can be utilized in experiments involving microspheres, as well as for the detection and analysis of activated cells expressing P-Selectin. Additionally, this antibody has shown affinity towards other proteins such as E-Cadherin, making it a versatile tool for studying cell adhesion and signaling pathways. With its high specificity and sensitivity, the P-Selectin antibody is a valuable asset in the field of immunology and molecular biology research.
KLRG1 antibody (biotin)
KLRG1 antibody (biotin) was raised in hamster using activated NK (A-LAK) cells from B6 mice as the immunogen.
Purity:Min. 95%ZBTB2 antibody
ZBTB2 antibody was raised in rabbit using the middle region of ZBTB2 as the immunogen
Purity:Min. 95%Goat anti Bovine IgG (H + L) (FITC)
Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&L) as the immunogen.
Purity:Min. 95%GHR antibody
The GHR antibody is a highly specialized monoclonal antibody that targets the hydrogen atom in natural compounds. It is designed to specifically bind to the dpp4 enzyme, inhibiting its activity and preventing the breakdown of certain hormones. This antibody is commonly used in life sciences research to study the role of dpp4 in various biological processes, including adipose tissue metabolism and hepatocyte growth. Additionally, this antibody can be utilized as a selectable marker in polymerase chain reaction (PCR) experiments or interferon assays. With its high affinity and specificity, the GHR antibody is an invaluable tool for scientists and researchers in the field of molecular biology.
Zika virus NS1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its effectiveness has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.CATSPER2 antibody
CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
SARS-CoV-2 Spike Antibody
The SARS-CoV-2 Spike Antibody is a highly effective inhibitor that belongs to the family of neutralizing antibodies. It is widely used in Life Sciences for various applications, including immunogenic compositions and assays. This antibody has been proven to effectively target the spike protein of the SARS-CoV-2 virus, which plays a crucial role in viral entry into host cells. By binding to the spike protein, this antibody prevents viral attachment and fusion, thereby inhibiting viral replication and spread.ANGPTL3 antibody
ANGPTL3 antibody was raised in rabbit using the N terminal of ANGPTL3 as the immunogen
Purity:Min. 95%MYH10 antibody
MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD
STAT1 antibody
The STAT1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to the STAT1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry.
Purity:Min. 95%SCYL3 antibody
SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV
Glycoprotein Ib antibody
Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Purity:Min. 95%TADA1L antibody
TADA1L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
IL6 antibody
IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a multifunctional cytokine involved in various biological processes. IL-6 acts as both a pro-inflammatory and anti-inflammatory mediator, playing a crucial role in immune response regulation. The IL6 antibody binds to IL-6 and neutralizes its activity, preventing it from binding to its receptors and initiating downstream signaling pathways.
BAFF antibody
The BAFF antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of BAFF (B-cell activating factor), a protein involved in the activation and survival of B-cells. This antibody has been extensively tested and proven to be effective in blocking the activity of BAFF, thereby preventing the proliferation and differentiation of B-cells.
Goat anti Rat IgG (Fab'2) (rhodamine)
Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(c) fragment as the immunogen.
Purity:Min. 95%MTRR antibody
MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
PKC gamma antibody
The PKC gamma antibody is a highly effective neutralizing monoclonal antibody that targets the protein kinase C gamma (PKCγ). This antibody acts as a potent family kinase inhibitor, blocking the activity of PKCγ and preventing its role in cell signaling pathways. By inhibiting PKCγ, this antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help inhibit the growth of blood vessels and limit angiogenesis. Additionally, it can bind to alpha-fetoprotein (AFP), a tumor marker expressed in certain cancers, and neutralize its effects.
TRPM5 antibody
TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV
Purity:Min. 95%IL1b antibody
The IL1b antibody is a monoclonal antibody that specifically targets IL-1β, a pro-inflammatory cytokine involved in various immune and inflammatory responses. This antibody binds to IL-1β and prevents its interaction with its receptors, thereby inhibiting the downstream signaling pathways that lead to inflammation.
Rat Thymocyte antibody
Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.
Purity:Min. 95%IARS2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The metabolization of this drug involves various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.
RALGPS2 antibody
RALGPS2 antibody was raised using the C terminal of RALGPS2 corresponding to a region with amino acids YLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDI
