Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
MYL3 antibody
MYL3 antibody was raised in Mouse using a purified recombinant fragment of MYL3 expressed in E. coli as the immunogen.
Cathepsin D antibody
The Cathepsin D antibody is a highly sensitive detection tool commonly used in immunoassays within the Life Sciences industry. This antibody is designed to specifically target and bind to Cathepsin D, an enzyme involved in various cellular processes. Its ultrasensitive detection capabilities make it ideal for research and diagnostic applications.
NOTCH3 antibody
The NOTCH3 antibody is a powerful tool in the field of Life Sciences. It specifically targets and binds to the activated form of NOTCH3, a growth factor involved in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.
SSTR2 antibody
The SSTR2 antibody is a highly specialized monoclonal antibody that targets the somatostatin receptor 2 (SSTR2). This antibody has been extensively studied and characterized for its ability to specifically bind to SSTR2, making it an invaluable tool in various research applications.
ATXN1 antibody
The ATXN1 antibody is a highly reactive and neutralizing polyclonal antibody that specifically targets the ATXN1 protein. This protein is involved in various cellular processes, including cell signaling and gene expression regulation. The ATXN1 antibody has been shown to be effective in blocking the activity of ATXN1, making it an ideal tool for studying its function and potential therapeutic applications. It can also be used as a diagnostic tool to detect the presence of autoantibodies against ATXN1 in human serum. The ATXN1 antibody is produced using advanced techniques and quality control measures to ensure its purity and specificity. With its high affinity and selectivity, this monoclonal antibody provides reliable results in various research settings.
STK24 antibody
The STK24 antibody is a polyclonal antibody that is highly effective in targeting and neutralizing cytotoxic factors in various biological samples, including pleural fluid, human serum, and tissue culture media. This antibody specifically binds to STK24, a protein kinase involved in the regulation of cell growth and survival. By binding to STK24, this antibody inhibits its activity and prevents the downstream signaling pathways that promote cell proliferation and survival.
Angiotensinogen antibody
The Angiotensinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize angiotensinogen, a protein that plays a key role in the regulation of blood pressure and fluid balance in the body. This antibody has been extensively studied and proven to be effective in blocking the activation of angiotensinogen, thereby preventing its interaction with other molecules such as atrial natriuretic peptide and albumin.
NOX1 antibody
The NOX1 antibody is a highly specialized polyclonal antibody that targets the oncostatin receptor. It is designed to specifically bind to glial fibrillary acidic protein (GFAP), an antigen expressed in glial cells. This antibody can be used for various applications, including immunohistochemistry and western blotting, to detect the presence and localization of GFAP in tissues or cell cultures.
CD71 antibody (Azide Free)
CD71 antibody (Azide free) was raised in rat using CD71/transferrin receptor as the immunogen.
OR51E2 antibody
The OR51E2 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. This antibody specifically targets and interacts with the OR51E2 protein, which plays a crucial role in cellular processes such as cell growth, proliferation, and differentiation.
RAD23A antibody
RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
MAG antibody
The MAG antibody is a highly specialized antibody that has various characteristics and applications. It is a DNA aptamer that acts as an active agent, capable of neutralizing the effects of SN-38, a potent cytotoxic compound. The MAG antibody can be used in various research and diagnostic applications due to its specificity and binding affinity.
CD2 antibody
The CD2 antibody is a monoclonal antibody that targets the CD2 protein, which plays a crucial role in T-cell activation and growth factor signaling. This antibody specifically binds to the activated form of CD2 and has been shown to inhibit T-cell proliferation and cytokine production. Additionally, it has hypomethylating properties, which may contribute to its anti-inflammatory effects. The CD2 antibody is commonly used in Life Sciences research for studying T-cell biology and immune responses. It can also be used in combination with other antibodies or inhibitors for antibody-drug conjugate therapy. Furthermore, this antibody has been utilized in various studies involving extracellular histones, tyrosine kinase inhibitors like imatinib, and intracellular signaling pathways such as p38 MAPK. Its versatility and specificity make it an invaluable tool for researchers in the field of immunology.
CRP antibody
CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
BRAF antibody
BRAF antibody was raised in Mouse using a purified recombinant fragment of human BRAF expressed in E. coli as the immunogen.
KCNH6 antibody
KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK
GILT antibody
The GILT antibody is a cytotoxic monoclonal antibody that specifically targets amyloid plaque protein dimers. It is widely used in Life Sciences research to study the formation and accumulation of amyloid plaques, which are associated with various neurodegenerative diseases such as Alzheimer's disease. This monoclonal antibody has high specificity and affinity for amyloid plaque protein dimers, making it an excellent tool for detecting and quantifying these abnormal protein aggregates. Additionally, the GILT antibody has been shown to have inhibitory effects on the growth factor signaling pathway, making it a potential therapeutic candidate for diseases characterized by excessive cell proliferation. With its exceptional quality and reliability, this antibody is a valuable asset for researchers investigating amyloid-related disorders.
NEDD9 antibody
NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
TNFSF13 antibody
TNFSF13 antibody was raised in rabbit using the middle region of TNFSF13 as the immunogen
FPR1 antibody
The FPR1 antibody is a highly specialized medicament used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to e-cadherin, a glycoprotein involved in cell adhesion. This colloidal antibody has been extensively studied for its inhibitory effects on e-cadherin expression and its potential as a therapeutic agent in various diseases.
Haptoglobin antibody
Haptoglobin antibody is a monoclonal antibody that specifically targets haptoglobin, a human protein found in plasma. It is widely used in Life Sciences research to study the role of haptoglobin in various biological processes. Haptoglobin antibody has been shown to bind to haptoglobin expressed in human hepatocytes and inhibit its function. This antibody can also be used for immunohistochemistry and Western blotting to detect haptoglobin levels in human serum samples. Additionally, haptoglobin antibody has been used in studies investigating the interaction between haptoglobin and other molecules such as fatty acids, lectins, and transport proteins. Its specificity and high affinity make it a valuable tool for researchers studying the functions of haptoglobin and its polymorphic variants.
IL4 antibody
IL4 antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It is commonly used in life sciences research and has various applications in the field. IL4 antibody can be used as a tool to study the role of interleukin-4 (IL-4) in immune responses and inflammation. It can also be used as an inhibitor to block the activity of IL-4, which is involved in anti-angiogenesis and other processes.
