Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
RB1 antibody
The RB1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the histidine receptor, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in blocking the actions of histidine, thereby modulating its effects on cellular signaling pathways.
MTHFR antibody
The MTHFR antibody is a glycosylated glycopeptide that belongs to the class of chemokines. It is used in the field of Life Sciences for various applications, including the detection and quantification of interferon-gamma (IFN-γ) in biological samples. This antibody specifically targets the nuclear protein MTHFR and can be used in experiments such as immunofluorescence and Western blotting. Additionally, it has been shown to have inhibitory effects on factors such as alpha-fetoprotein and β-catenin, making it a valuable tool for studying signal transduction pathways. With its high specificity and affinity, the MTHFR antibody is an essential component for researchers working in the field of molecular biology and cellular signaling.
Caspase 8 antibody
The Caspase 8 antibody is a specific monoclonal antibody used for various applications in the field of Life Sciences. It is designed to target and detect caspase 8, an enzyme involved in apoptosis (programmed cell death). This antibody has been extensively tested and validated using human serum samples to ensure its accuracy and reliability.
OTC antibody
OTC antibody was raised using the N terminal of OTC corresponding to a region with amino acids AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD
GABRA3 antibody
The GABRA3 antibody is a biomolecule that specifically targets and inhibits the GABRA3 protein. It is available as a monoclonal antibody, which ensures high specificity and potency. This antibody can be used for various applications in the field of Life Sciences, such as immunoassays, electrophoresis, and colloid-based assays.
His Tag antibody
The His Tag antibody is a valuable tool in the field of Life Sciences. It is a monoclonal antibody that specifically recognizes and binds to the His tag, which is commonly used as an antigen in protein purification and detection. The His tag is a short sequence of amino acids that can be genetically fused to a target protein, allowing for easy purification using affinity chromatography techniques. This antibody offers high specificity and sensitivity, making it ideal for various applications such as Western blotting, immunoprecipitation, and ELISA assays. It can be used to detect and quantify His-tagged proteins in complex samples, enabling researchers to study protein expression levels and interactions. The His Tag antibody is compatible with a wide range of detection methods including chemiluminescence, fluorescence, and colorimetric assays. Its versatility makes it suitable for use in both research and industrial settings. Whether you are studying protein-protein interactions, investigating cellular signaling pathways, or developing new therapeutic drugs, the His Tag antibody is an
Notch 2 antibody
The Notch 2 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the Notch 2 protein, which plays a crucial role in various cellular processes including fibrinogen regulation, epidermal growth factor signaling, chemokine expression, and carbamazepine metabolism. This antibody has neutralizing and cytotoxic effects on cells expressing Notch 2, making it a valuable tool for studying the function of this protein. Additionally, the Notch 2 antibody can be used in diagnostic applications to detect the presence of Notch 2 in tissues or biological samples. Its high specificity and sensitivity make it an excellent choice for researchers and clinicians working with Notch 2-related pathways and diseases.
CCR5 antibody
The CCR5 antibody is a monoclonal antibody that specifically targets the CCR5 receptor, which is a cation-binding protein involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in immunoassays and therapeutic applications.
TNFR1 antibody
TNFR1 antibody is a highly specific antibody that targets the tumor necrosis factor receptor 1 (TNFR1). It binds to TNFR1 and inhibits its activity, thereby blocking the binding of TNF-α and preventing downstream signaling pathways. This antibody has been extensively studied in various fields of Life Sciences, including cancer research, immunology, and molecular biology.
STAP2 antibody
The STAP2 antibody is a highly specialized antibody that targets and neutralizes the activity of STAP2, a protein involved in various cellular processes. This polyclonal antibody is designed to specifically bind to the activated form of STAP2 and inhibit its function. By blocking the interaction between STAP2 and other proteins such as lipoprotein lipase and growth factors, this antibody helps regulate important biological pathways.
HAX1 antibody
The HAX1 antibody is an antiviral medication that acts as an inhibitor of methyl transferase. It plays a crucial role in the regulation of interleukin and serves as a serum marker in Life Sciences. This biomarker composition has been shown to be effective in detecting autoantibodies and is widely used in high-flux monoclonal antibody therapy. The HAX1 antibody is a potent medicament that targets specific cation channels and carnitine, making it an essential component for various medical applications. With its remarkable efficacy and versatility, the HAX1 antibody offers promising solutions for combating viral infections and promoting overall health.
SLC6A1 antibody
The SLC6A1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It has been specifically designed to target and bind to the SLC6A1 protein, also known as the glycine transporter 1. This protein plays a crucial role in the transport of glycine, an important neurotransmitter involved in synaptic signaling.
RPB8 antibody
The RPB8 antibody is an acidic monoclonal antibody that belongs to the colony-stimulating factor family. It is widely used in life sciences research for its ability to specifically bind to RPB8, a subunit of RNA polymerase II. This antibody has been shown to have toxic effects on cancer cells and can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The RPB8 antibody can also be used in combination with other antibodies, such as alpha-fetoprotein or vasoactive intestinal peptide, to study their interactions and signaling pathways. Additionally, this antibody has been shown to modulate the activity of phosphatases and interferons, making it a valuable tool for studying cellular processes and immune responses.
Cytokeratin 8 antibody
Cytokeratin 8 antibody is a neutralizing monoclonal antibody that targets collagen. It is used in Life Sciences research to study the role of cytokeratin 8 in various cellular processes. This antibody can specifically bind to cytokeratin 8, which is an intermediate filament protein found in epithelial cells. By targeting cytokeratin 8, this antibody can help researchers investigate its interactions with other proteins such as e-cadherin and β-catenin, as well as its involvement in signaling pathways mediated by growth factors like epidermal growth factor and TGF-beta. Additionally, the use of this antibody has been shown to correlate with changes in microvessel density and activation of certain cellular processes. With its high specificity and affinity for cytokeratin 8, this antibody is a valuable tool for studying the biology of epithelial cells and their associated diseases.
Fascin antibody
Fascin antibody is a highly specific monoclonal antibody that targets fascin, a protein involved in cell migration and adhesion. It binds to histidine residues on the fascin molecule, inhibiting its function and preventing tumor metastasis. This antibody has been extensively studied in various research fields, including cancer biology and immunology. Fascin antibody can be used in experiments to detect fascin expression levels in human serum samples or tissue sections. Additionally, it has been shown to have cytotoxic effects on cancer cells and can be used as a therapeutic agent in cancer treatment. The use of this antibody has also been explored in autoimmune diseases, where autoantibodies targeting fascin have been identified. Overall, Fascin antibody is a valuable tool for researchers in the Life Sciences field who are studying cell migration, tumor metastasis, and autoimmunity.
FMO2 antibody
The FMO2 antibody is a monoclonal antibody that has been developed for its potential use as a medicament in the field of Life Sciences. This antibody exhibits cytotoxic properties and has been shown to induce cell cytotoxicity in various studies. It specifically targets and binds to a growth factor known as phosphorylcholine, inhibiting its activity and preventing further cell growth.
Troponin I antibody
The Troponin I antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize Troponin I, a glycoprotein involved in muscle contraction. This antibody has been extensively studied and proven to have high affinity and specificity for Troponin I.VDAC1 antibody
VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
BCAT1 antibody
The BCAT1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be effective in studying the receptor binding of certain substances. This antibody is particularly useful in the field of oncology, as it can help researchers understand the mechanisms behind cancer growth and potentially develop targeted therapies.
DNA polymerase delta cat antibody
Affinity purified Rabbit polyclonal DNA polymerase delta cat antibody
RBP1 antibody
The RBP1 antibody is a monoclonal antibody that specifically targets the TGF-beta1 protein. It can be used in various research applications in Life Sciences, such as studying the effects of TGF-beta1 on cellular processes and signaling pathways. The RBP1 antibody has been shown to neutralize the activity of TGF-beta1, which plays a crucial role in cell growth, differentiation, and immune response regulation. Additionally, this antibody can be used in combination with other antibodies or drugs, such as imatinib or interferon, to investigate potential synergistic effects. Its high specificity and affinity make it an excellent tool for studying TGF-beta1-related mechanisms and developing therapeutic interventions.
RORA antibody
RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
NFS1 antibody
NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV
