CymitQuimica logo
Primary Antibodies

Primary Antibodies

Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.

Subcategories of "Primary Antibodies"

Show 1 more subcategories

Found 75602 products of "Primary Antibodies"

Sort by

Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
products per page.
  • RB1 antibody


    The RB1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the histidine receptor, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in blocking the actions of histidine, thereby modulating its effects on cellular signaling pathways.

    Ref: 3D-70R-50312

    1u
    Discontinued
    100µl
    Discontinued
    Discontinued product
  • MTHFR antibody


    The MTHFR antibody is a glycosylated glycopeptide that belongs to the class of chemokines. It is used in the field of Life Sciences for various applications, including the detection and quantification of interferon-gamma (IFN-γ) in biological samples. This antibody specifically targets the nuclear protein MTHFR and can be used in experiments such as immunofluorescence and Western blotting. Additionally, it has been shown to have inhibitory effects on factors such as alpha-fetoprotein and β-catenin, making it a valuable tool for studying signal transduction pathways. With its high specificity and affinity, the MTHFR antibody is an essential component for researchers working in the field of molecular biology and cellular signaling.

    Ref: 3D-70R-13544

    100µl
    Discontinued
    Discontinued product
  • LPIN2 antibody


    LPIN2 antibody was raised in rabbit using the C terminal of LPIN2 as the immunogen

    Ref: 3D-70R-10338

    100µl
    Discontinued
    Discontinued product
  • Caspase 8 antibody


    The Caspase 8 antibody is a specific monoclonal antibody used for various applications in the field of Life Sciences. It is designed to target and detect caspase 8, an enzyme involved in apoptosis (programmed cell death). This antibody has been extensively tested and validated using human serum samples to ensure its accuracy and reliability.

    Ref: 3D-70R-14063

    100µg
    Discontinued
    Discontinued product
  • OTC antibody


    OTC antibody was raised using the N terminal of OTC corresponding to a region with amino acids AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD

    Ref: 3D-70R-1117

    100µl
    Discontinued
    Discontinued product
  • GABRA3 antibody


    The GABRA3 antibody is a biomolecule that specifically targets and inhibits the GABRA3 protein. It is available as a monoclonal antibody, which ensures high specificity and potency. This antibody can be used for various applications in the field of Life Sciences, such as immunoassays, electrophoresis, and colloid-based assays.

    Ref: 3D-70R-14979

    100µl
    Discontinued
    Discontinued product
  • AIFM1 antibody


    AIFM1 antibody was raised in rabbit using the middle region of AIFM1 as the immunogen

    Ref: 3D-70R-10447

    100µl
    Discontinued
    Discontinued product
  • His Tag antibody


    The His Tag antibody is a valuable tool in the field of Life Sciences. It is a monoclonal antibody that specifically recognizes and binds to the His tag, which is commonly used as an antigen in protein purification and detection. The His tag is a short sequence of amino acids that can be genetically fused to a target protein, allowing for easy purification using affinity chromatography techniques. This antibody offers high specificity and sensitivity, making it ideal for various applications such as Western blotting, immunoprecipitation, and ELISA assays. It can be used to detect and quantify His-tagged proteins in complex samples, enabling researchers to study protein expression levels and interactions. The His Tag antibody is compatible with a wide range of detection methods including chemiluminescence, fluorescence, and colorimetric assays. Its versatility makes it suitable for use in both research and industrial settings. Whether you are studying protein-protein interactions, investigating cellular signaling pathways, or developing new therapeutic drugs, the His Tag antibody is an

    Ref: 3D-70R-10654

    400µl
    Discontinued
    Discontinued product
  • Notch 2 antibody


    The Notch 2 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the Notch 2 protein, which plays a crucial role in various cellular processes including fibrinogen regulation, epidermal growth factor signaling, chemokine expression, and carbamazepine metabolism. This antibody has neutralizing and cytotoxic effects on cells expressing Notch 2, making it a valuable tool for studying the function of this protein. Additionally, the Notch 2 antibody can be used in diagnostic applications to detect the presence of Notch 2 in tissues or biological samples. Its high specificity and sensitivity make it an excellent choice for researchers and clinicians working with Notch 2-related pathways and diseases.

    Ref: 3D-70R-31091

    1u
    Discontinued
    100µg
    Discontinued
    Discontinued product
  • CCR5 antibody


    The CCR5 antibody is a monoclonal antibody that specifically targets the CCR5 receptor, which is a cation-binding protein involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in immunoassays and therapeutic applications.

    Ref: 3D-70R-13699

    100µg
    Discontinued
    Discontinued product
  • TRADD antibody


    TRADD antibody was raised in rabbit using the middle region of TRADD as the immunogen

    Ref: 3D-70R-10446

    ne
    Discontinued
    100µl
    Discontinued
    Discontinued product
  • TNFR1 antibody


    TNFR1 antibody is a highly specific antibody that targets the tumor necrosis factor receptor 1 (TNFR1). It binds to TNFR1 and inhibits its activity, thereby blocking the binding of TNF-α and preventing downstream signaling pathways. This antibody has been extensively studied in various fields of Life Sciences, including cancer research, immunology, and molecular biology.

    Ref: 3D-70R-13806

    100µg
    Discontinued
    Discontinued product
  • HCE antibody


    Affinity purified Rabbit polyclonal HCE antibody

    Ref: 3D-70R-12921

    100µl
    Discontinued
    Discontinued product
  • STAP2 antibody


    The STAP2 antibody is a highly specialized antibody that targets and neutralizes the activity of STAP2, a protein involved in various cellular processes. This polyclonal antibody is designed to specifically bind to the activated form of STAP2 and inhibit its function. By blocking the interaction between STAP2 and other proteins such as lipoprotein lipase and growth factors, this antibody helps regulate important biological pathways.

    Ref: 3D-70R-12977

    100µl
    Discontinued
    Discontinued product
  • KIAA1967 antibody


    Rabbit polyclonal KIAA1967 antibody

    Ref: 3D-70R-31999

    100µg
    Discontinued
    Discontinued product
  • APRT antibody


    Affinity purified Rabbit polyclonal APRT antibody

    Ref: 3D-70R-13292

    100µl
    Discontinued
    Discontinued product
  • HAX1 antibody


    The HAX1 antibody is an antiviral medication that acts as an inhibitor of methyl transferase. It plays a crucial role in the regulation of interleukin and serves as a serum marker in Life Sciences. This biomarker composition has been shown to be effective in detecting autoantibodies and is widely used in high-flux monoclonal antibody therapy. The HAX1 antibody is a potent medicament that targets specific cation channels and carnitine, making it an essential component for various medical applications. With its remarkable efficacy and versatility, the HAX1 antibody offers promising solutions for combating viral infections and promoting overall health.

    Ref: 3D-70R-15390

    100µg
    Discontinued
    Discontinued product
  • RPA32 antibody


    Affinity purified Rabbit polyclonal RPA32 antibody

    Ref: 3D-70R-13515

    100µl
    Discontinued
    Discontinued product
  • EIF4EBP2 antibody


    EIF4EBP2 antibody was raised in Rabbit using Human EIF4EBP2 as the immunogen

    Ref: 3D-70R-17059

    50µl
    Discontinued
    Discontinued product
  • SLC6A1 antibody


    The SLC6A1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It has been specifically designed to target and bind to the SLC6A1 protein, also known as the glycine transporter 1. This protein plays a crucial role in the transport of glycine, an important neurotransmitter involved in synaptic signaling.

    Ref: 3D-70R-14258

    100µg
    Discontinued
    Discontinued product
  • RPB8 antibody


    The RPB8 antibody is an acidic monoclonal antibody that belongs to the colony-stimulating factor family. It is widely used in life sciences research for its ability to specifically bind to RPB8, a subunit of RNA polymerase II. This antibody has been shown to have toxic effects on cancer cells and can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The RPB8 antibody can also be used in combination with other antibodies, such as alpha-fetoprotein or vasoactive intestinal peptide, to study their interactions and signaling pathways. Additionally, this antibody has been shown to modulate the activity of phosphatases and interferons, making it a valuable tool for studying cellular processes and immune responses.

    Ref: 3D-70R-13624

    100µl
    Discontinued
    Discontinued product
  • Cytokeratin 8 antibody


    Cytokeratin 8 antibody is a neutralizing monoclonal antibody that targets collagen. It is used in Life Sciences research to study the role of cytokeratin 8 in various cellular processes. This antibody can specifically bind to cytokeratin 8, which is an intermediate filament protein found in epithelial cells. By targeting cytokeratin 8, this antibody can help researchers investigate its interactions with other proteins such as e-cadherin and β-catenin, as well as its involvement in signaling pathways mediated by growth factors like epidermal growth factor and TGF-beta. Additionally, the use of this antibody has been shown to correlate with changes in microvessel density and activation of certain cellular processes. With its high specificity and affinity for cytokeratin 8, this antibody is a valuable tool for studying the biology of epithelial cells and their associated diseases.

    Ref: 3D-70R-13833

    100µg
    Discontinued
    Discontinued product
  • PEX13 antibody


    Affinity purified Rabbit polyclonal PEX13 antibody

    Ref: 3D-70R-12990

    100µl
    Discontinued
    Discontinued product
  • FAM3C antibody


    FAM3C antibody was raised in Rabbit using Human FAM3C as the immunogen

    Ref: 3D-70R-17220

    50µl
    Discontinued
    Discontinued product
  • GABRB2 antibody


    Rabbit polyclonal GABRB2 antibody

    Ref: 3D-70R-14985

    100µl
    Discontinued
    Discontinued product
  • MKNK1 antibody


    Rabbit polyclonal MKNK1 antibody

    Ref: 3D-70R-32104

    100µg
    Discontinued
    Discontinued product
  • Fascin antibody


    Fascin antibody is a highly specific monoclonal antibody that targets fascin, a protein involved in cell migration and adhesion. It binds to histidine residues on the fascin molecule, inhibiting its function and preventing tumor metastasis. This antibody has been extensively studied in various research fields, including cancer biology and immunology. Fascin antibody can be used in experiments to detect fascin expression levels in human serum samples or tissue sections. Additionally, it has been shown to have cytotoxic effects on cancer cells and can be used as a therapeutic agent in cancer treatment. The use of this antibody has also been explored in autoimmune diseases, where autoantibodies targeting fascin have been identified. Overall, Fascin antibody is a valuable tool for researchers in the Life Sciences field who are studying cell migration, tumor metastasis, and autoimmunity.

    Ref: 3D-70R-14112

    100µg
    Discontinued
    Discontinued product
  • FMO2 antibody


    The FMO2 antibody is a monoclonal antibody that has been developed for its potential use as a medicament in the field of Life Sciences. This antibody exhibits cytotoxic properties and has been shown to induce cell cytotoxicity in various studies. It specifically targets and binds to a growth factor known as phosphorylcholine, inhibiting its activity and preventing further cell growth.

    Ref: 3D-70R-13320

    100µl
    Discontinued
    Discontinued product
  • FECH antibody


    FECH antibody was raised in Rabbit using Human FECH as the immunogen

    Ref: 3D-70R-17278

    50µl
    Discontinued
    Discontinued product
  • LOC283129 antibody


    Affinity purified Rabbit polyclonal LOC283129 antibody

    Ref: 3D-70R-13029

    100µl
    Discontinued
    Discontinued product
  • ZFP 140 antibody


    Affinity purified Rabbit polyclonal ZFP 140 antibody

    Ref: 3D-70R-12751

    100µl
    Discontinued
    Discontinued product
  • Troponin I antibody


    The Troponin I antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize Troponin I, a glycoprotein involved in muscle contraction. This antibody has been extensively studied and proven to have high affinity and specificity for Troponin I.

    Ref: 3D-10-7967

    1mg
    Discontinued
    Discontinued product
  • FABP2 antibody


    Affinity purified Mouse polyclonal FABP2 antibody

    Ref: 3D-70R-13991

    100µg
    Discontinued
    Discontinued product
  • ACSS1 antibody


    ACSS1 antibody was raised in Rabbit using Human ACSS1 as the immunogen

    Ref: 3D-70R-15558

    50µl
    Discontinued
    Discontinued product
  • VDAC1 antibody


    VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

    Ref: 3D-70R-1541

    100µl
    Discontinued
    Discontinued product
  • BCAT1 antibody


    The BCAT1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be effective in studying the receptor binding of certain substances. This antibody is particularly useful in the field of oncology, as it can help researchers understand the mechanisms behind cancer growth and potentially develop targeted therapies.

    Ref: 3D-70R-14077

    100µg
    Discontinued
    Discontinued product
  • CMAS antibody


    Affinity purified Rabbit polyclonal CMAS antibody

    Ref: 3D-70R-12891

    100µl
    Discontinued
    Discontinued product
  • CCNH antibody


    CCNH antibody was raised in Rabbit using Human CCNH as the immunogen

    Ref: 3D-70R-16238

    50µl
    Discontinued
    Discontinued product
  • ABH1 antibody


    Affinity purified Rabbit polyclonal ABH1 antibody

    Ref: 3D-70R-13637

    100µl
    Discontinued
    Discontinued product
  • NUDT6 antibody


    NUDT6 antibody was raised in rabbit using the middle region of NUDT6 as the immunogen

    Ref: 3D-70R-10412

    100µl
    Discontinued
    Discontinued product
  • MYOT antibody


    MYOT antibody was raised in Rabbit using Human MYOT as the immunogen

    Ref: 3D-70R-18733

    50µl
    Discontinued
    Discontinued product
  • SGTA antibody


    Affinity purified Rabbit polyclonal SGTA antibody

    Ref: 3D-70R-12587

    100µl
    Discontinued
    Discontinued product
  • DUOXA1 antibody


    DUOXA1 antibody was raised in rabbit using the C terminal of DUOXA1 as the immunogen

    Ref: 3D-70R-10265

    100µl
    Discontinued
    Discontinued product
  • DNA polymerase delta cat antibody


    Affinity purified Rabbit polyclonal DNA polymerase delta cat antibody

    Ref: 3D-70R-12690

    100µl
    Discontinued
    Discontinued product
  • SART1 antibody


    Affinity purified Rabbit polyclonal SART1 antibody

    Ref: 3D-70R-13405

    100µl
    Discontinued
    Discontinued product
  • RBP1 antibody


    The RBP1 antibody is a monoclonal antibody that specifically targets the TGF-beta1 protein. It can be used in various research applications in Life Sciences, such as studying the effects of TGF-beta1 on cellular processes and signaling pathways. The RBP1 antibody has been shown to neutralize the activity of TGF-beta1, which plays a crucial role in cell growth, differentiation, and immune response regulation. Additionally, this antibody can be used in combination with other antibodies or drugs, such as imatinib or interferon, to investigate potential synergistic effects. Its high specificity and affinity make it an excellent tool for studying TGF-beta1-related mechanisms and developing therapeutic interventions.

    Ref: 3D-70R-12617

    100µl
    Discontinued
    Discontinued product
  • ALDH1B1 antibody


    ALDH1B1 antibody was raised in Rabbit using Human ALDH1B1 as the immunogen

    Ref: 3D-70R-15665

    50µl
    Discontinued
    Discontinued product
  • RORA antibody


    RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids  GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

    Ref: 3D-70R-1006

    100µl
    Discontinued
    Discontinued product
  • 5HT1A antibody


    Rabbit polyclonal 5HT1A antibody

    Ref: 3D-70R-32257

    100µg
    Discontinued
    Discontinued product
  • NFS1 antibody


    NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV

    Ref: 3D-70R-1097

    100µl
    Discontinued
    Discontinued product