Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
ZDHHC19 antibody
ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR
Purity:Min. 95%ZFP14 antibody
ZFP14 antibody was raised in rabbit using the N terminal of ZFP14 as the immunogen
Purity:Min. 95%CD68 antibody
The CD68 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD68, a glycoprotein that is expressed on the surface of activated macrophages, adipose tissue cells, and certain types of collagen. This antibody is widely used in research and diagnostic applications to detect the presence of CD68 in various biological samples, such as human serum or tissues.
Methcathinone Antibody
The Methcathinone Antibody is a highly specialized antibody that exhibits insulin-like properties and interferes with the function of specific antigens. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to effectively bind to recombinant proteins, growth factors, interleukins, and IFN-gamma, inhibiting their activity and preventing their interaction with target receptors. Additionally, this antibody has been immobilized on activated fatty acids, allowing for easy purification and isolation of target molecules. With its unique tyrosine-based structure, the Methcathinone Antibody offers a valuable tool for researchers in need of a reliable and efficient method for studying sumoylation processes and investigating the role of specific antigens in cellular functions.
ZNF382 antibody
ZNF382 antibody was raised in rabbit using the N terminal of ZNF382 as the immunogen
Purity:Min. 95%EPO antibody
The EPO antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody is designed to neutralize arginase, an enzyme that plays a crucial role in various biological processes. The EPO antibody has been extensively tested and validated through electrophoresis techniques to ensure its high quality and efficacy.
SLAMF7 antibody
The SLAMF7 antibody is a highly specialized biomolecule that acts as a growth factor and protein kinase. It is commonly used in Life Sciences research and has proven to be an invaluable tool for scientists in various fields. This monoclonal antibody specifically targets the interleukin-15 receptor, which plays a crucial role in immune response regulation.
PPM1B antibody
The PPM1B antibody is a monoclonal antibody that targets the phosphatase enzyme PPM1B. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically recognizes and binds to PPM1B, inhibiting its activity and preventing its interaction with other molecules.
BTK antibody
The BTK antibody is a powerful tool in the field of Life Sciences. It targets the Bruton's tyrosine kinase (BTK), which plays a crucial role in various cellular processes. This antibody can be used for research purposes, such as studying the effects of BTK inhibition on cell signaling pathways and protein kinase activity.
IFN gamma antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.
GAPDH antibody
The GAPDH antibody is a highly effective monoclonal antibody that has been activated to target specific proteins in the body. It is commonly used in Life Sciences research to study various cellular processes and pathways. This antibody has been found to neutralize the activity of TGF-beta, a protein involved in cell growth and differentiation. Additionally, it has shown to have glycosylation properties, which can impact protein function and stability. One of the key targets of the GAPDH antibody is E-cadherin, a protein responsible for cell adhesion and tissue integrity. By binding to E-cadherin, this antibody can modulate cell-cell interactions and potentially influence cellular behavior. Furthermore, studies have demonstrated that the GAPDH antibody can inhibit collagen production, which is crucial for maintaining tissue structure and elasticity. This property may have implications in wound healing and tissue regeneration. Another important aspect of the GAPDH antibody is its ability to regulate microvessel density. By targeting specific proteins involved in angiogenesis, thisAnti-PGII antibody
The Anti-PGII antibody is a highly specialized drug antibody that is used in immunoassays within the field of Life Sciences. This antibody specifically targets and neutralizes the effects of PGII, a fatty acid known for its role in adipose tissue. By neutralizing PGII, this antibody helps to regulate viscosity levels and maintain proper adipose function. Additionally, it has been found to have antiestrogen properties and can inhibit the activity of cdk4/6, enzymes involved in cell division. The Anti-PGII antibody is a monoclonal antibody, meaning it is derived from a single clone of cells and offers high specificity and potency in its action. With its ability to target and modulate various biological processes, this antibody holds great promise for research and therapeutic applications within the field of Life Sciences.Purity:≥90% By Sds-Pageanti-Canine Parvovirus Antibody
Canine parvovirus (CPV) is a highly contagious viral infection that affects dogs, especially puppies and young dogs. The virus belongs to the Parvoviridae family and is closely related to feline panleukopenia virus (FPV), which affects cats.;This Monoclonal anti-Canine Parvovirus antibody is suitable for ELISA and LFD applications. Suggest using as capture antibody in LFD format.Purity:Min. 95%Rabbit anti Human IgG (biotin)
Rabbit anti-human IgG (biotin) was raised in rabbit using human IgG F(c) fragment as the immunogen.Purity:Min. 95%OCT4 antibody
OCT4 antibody was raised in Mouse using a purified recombinant fragment of OCT4 expressed in E. coli as the immunogen.
PAPPA antibody
PAPPA antibody was raised in mouse using purified human PAPP-A/proMBP complex or purified human atherosclerotic tissue form of PAPP-A as the immunogen.PDIA4 antibody
PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL
Purity:Min. 95%HSPA1A antibody
The HSPA1A antibody is a monoclonal antibody that specifically targets the glycoprotein HSPA1A. This antibody has been shown to have multiple functions, including its ability to inhibit interferon and leukemia inhibitory factor signaling pathways. Additionally, it has been found to have antiphospholipid antibodies and antiviral activity. The HSPA1A antibody also acts as an inhibitor of dopamine release and exhibits cytotoxic effects on certain hormone peptides. Furthermore, it has been used as an anticoagulant in human serum and has been shown to target autoantibodies. With its diverse range of functions, the HSPA1A antibody holds great potential for various therapeutic applications.MEPE antibody
MEPE antibody was raised in rabbit using the middle region of MEPE as the immunogen
Purity:Min. 95%UXT antibody
UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
anti-Coronavirus (SARS-CoV-2) COVID Monoclonal
Monoclonal antibody raised against COVID (SARS-CoV-2) nucleoprotein. This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations.Purity:Min. 95%ZNF319 antibody
ZNF319 antibody was raised in rabbit using the N terminal of ZNF319 as the immunogenPurity:Min. 95%Survivin antibody
The Survivin antibody is a monoclonal antibody that targets survivin, a protein that plays a crucial role in cell division and inhibition of apoptosis. This antibody specifically binds to survivin and can be used for various applications in Life Sciences research.
