Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
S6K1 antibody
The S6K1 antibody is a potent inhibitor of thrombocytopenia, which is the condition of having low platelet count. It works by blocking the action of interleukin-6, a cytokine that plays a role in platelet production. This monoclonal antibody is widely used in Life Sciences research as a tool to study the function of S6K1, a family kinase involved in cell growth and proliferation. In addition to its use as a research tool, this antibody also has potential therapeutic applications. Its inhibitory effects on S6K1 make it a promising candidate for the development of targeted therapies against diseases characterized by abnormal cell growth, such as cancer. Furthermore, it has been shown to have an impact on viscosity regulation and can modulate the activity of various growth factors and chemokines involved in tissue repair and regeneration. Whether you are studying mesenchymal stem cells or investigating the role of epidermal growth factor or collagen in certain conditions, this
Purity:Min. 95%Tau antibody
The Tau antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target and neutralize the effects of tau proteins. Tau proteins are known for their involvement in various neurodegenerative diseases, such as Alzheimer's disease.
ZDHHC17 antibody
ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
BIRC5 antibody
The BIRC5 antibody is a monoclonal antibody that targets the growth factor known as neurotrophic factors. It acts as a neuroprotective agent by inhibiting the activity of phosphatase enzymes, which play a critical role in cell survival and growth. This antibody has shown promising results in studies involving sphingosine-induced neuronal death and pancreatic glucagon secretion. The BIRC5 antibody is produced using recombinant antigen technology and purified using cellulose-based chromatography methods. It can be used in various applications within the Life Sciences field, including research, diagnostics, and therapeutic development. This highly specific antibody is suitable for use in immunoassays, such as ELISA or Western blotting, to detect the presence of BIRC5 in samples such as blood plasma or tissue lysates. Its high affinity binding to BIRC5 makes it an ideal tool for studying cellular processes regulated by this growth factor.
NCS1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug that belongs to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This powerful drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.
PUF60 antibody
The PUF60 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the PUF60 protein, which is involved in various cellular processes. This antibody can be used to study the role of PUF60 in different biological pathways, such as RNA processing, DNA repair, and gene expression regulation. The PUF60 antibody has been widely used as a tool for investigating the function and localization of PUF60 within cells. It can be utilized in techniques like immunofluorescence and immunohistochemistry to visualize the distribution of PUF60 in various tissues and cell types. Additionally, this antibody can also be used for protein-protein interaction studies or as an inhibitor by blocking the activity of PUF60. Overall, the PUF60 antibody is a valuable tool for researchers studying the functions and mechanisms of the PUF60 protein in cellular processes.
VIM antibody
The VIM antibody is a monoclonal antibody that targets the interleukin-6 (IL-6) chemokine. It specifically binds to galectin-3-binding protein (LGALS3BP), which plays a crucial role in various biological processes, including cell growth and proliferation. The VIM antibody can be used in research applications to study protein-protein interactions and investigate the function of LGALS3BP in different cellular pathways.
TGF alpha antibody
The TGF alpha antibody is a monoclonal antibody that specifically targets the growth factor known as transforming growth factor alpha (TGF alpha). TGF alpha is a glycoprotein that plays a crucial role in cell proliferation and differentiation. By binding to TGF alpha, this antibody inhibits its activity and prevents it from interacting with its receptor on the cell surface.
Dhh antibody
Dhh antibody is a monoclonal antibody that specifically targets the Dhh protein, which is a growth factor involved in the development and maintenance of pluripotent stem cells. This antibody has been extensively studied and shown to have high specificity and affinity for Dhh, making it an ideal tool for research purposes. It can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry. The Dhh antibody has been validated using primary cells and has shown excellent performance in detecting Dhh expression in various tissues. Its unique amino-acid sequences allow it to recognize specific epitopes on the Dhh protein, ensuring accurate and reliable results. Furthermore, this antibody has potential as a biomarker for certain diseases or conditions related to Dhh signaling pathway dysregulation. Its use can provide valuable insights into the biological effects of Dhh and its role in cellular processes such as syncytia formation.
Goat anti Mouse IgM (biotin)
Goat anti-mouse IgM (biotin) was raised in goat using murine IgM heavy chain as the immunogen.
Purity:Min. 95%USP22 antibody
USP22 antibody was raised using the middle region of USP22 corresponding to a region with amino acids PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE
Tetraspanin 17 antibody
Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWIPurity:Min. 95%HSP60 antibody
The HSP60 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the acyl-CoA-binding protein (ACBP) and can be used in various immunoassays to detect and measure the levels of ACBP in different samples. ACBP is a glycoprotein that plays a crucial role in fatty acid metabolism and transport within cells. The HSP60 antibody can be used to study the expression and localization of ACBP in different cell types, including human endothelial cells and adipose tissue. It can also be used to investigate the interaction between ACBP and other proteins, such as growth factors, in order to better understand their roles in cellular processes. The HSP60 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. Its high specificity and sensitivity make it an invaluable tool for studying the functions of ACBP in cellular biology.
PODXL antibody
PODXL antibody was raised using the N terminal of PODXL corresponding to a region with amino acids TTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT
MURF1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes.
Triiodothyronine antibody
Triiodothyronine antibody was raised in mouse using triiodothyronine-BSA as the immunogen.Purity:Min. 95%POU2F1 antibody
The POU2F1 antibody is a highly specialized monoclonal antibody that targets the growth factor POU2F1. This antibody has been extensively tested and validated for use in various assays, including those involving human serum and adipose tissue. It specifically recognizes the tyrosine residues of the nuclear POU2F1 protein, allowing for its easy detection and immobilization in experiments.
CD18 antibody
The CD18 antibody is an essential tool in the field of Life Sciences. It belongs to the category of antibodies and is widely used for research purposes. This antibody specifically targets CD18, a protein that plays a crucial role in cell adhesion and immune response.
BMP10 antibody
The BMP10 antibody is a highly specialized monoclonal antibody that targets mesothelin, a protein expressed in various cancers such as pancreatic, ovarian, and lung cancer. This antibody has been shown to inhibit the growth of amyloid plaques associated with Alzheimer's disease and reduce the expression of osteopontin, a protein involved in tumor progression. The BMP10 antibody can be used in various life science research applications, including immunohistochemistry, western blotting, and flow cytometry. It has also been shown to modulate the activity of β-catenin and oncostatin M signaling pathways. With its high specificity and affinity for mesothelin, this antibody is a valuable tool for studying cancer biology and developing targeted therapies.
CDK5 antibody
The CDK5 antibody is a highly effective neutralizing agent that specifically targets the cyclin-dependent kinase 5 (CDK5). This monoclonal antibody has been extensively studied and has shown remarkable results in inhibiting the activity of CDK5. By binding to CDK5, this antibody prevents its interaction with other proteins and disrupts the signaling pathways involved in cell proliferation and differentiation.
AVPV1a antibody
AVPV1a antibody was raised in rabbit using 19aa peptide of rat AVP-VIa receptor. as the immunogen.Purity:Min. 95%
