Primary Antibodies

The p53 antibody is a highly specialized cytotoxic antibody that plays a crucial role in regulating cell growth and preventing tumor formation. It is known for its ability to target and neutralize antiphospholipid antibodies, which can lead to autoimmune disorders. Additionally, the p53 antibody has been shown to inhibit the activity of tyrosinase, an enzyme involved in melanin production, making it a potential treatment option for hyperpigmentation disorders.

The p73 antibody is an essential tool in the field of life sciences. It specifically targets the epidermal growth factor and acts as an endonuclease, which is crucial for DNA repair and maintenance. The p73 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.

Streptococcus group A antibody (biotin) was raised in rabbit using group A Streptococci as the immunogen.

The Albendazole antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and monoclonal antibodies, which are widely used as inhibitors in various research applications. This antibody specifically targets endothelial growth factor, making it a valuable tool for studying angiogenesis and related processes.

CYP2E1 antibody was raised in rabbit using a synthetic peptide as the immunogen.

Affinity purified Rabbit polyclonal PASK antibody

Armenian Hamster monoclonal CD48 antibody (biotin)

Affinity purified Rabbit polyclonal GCM2 antibody

KLRG1 antibody (PE) was raised in hamster using activated NK (A-LAK) cells from B6 mice as the immunogen.

GPR171 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Keratin K4 antibody was raised in Guinea Pig using synthetic peptide of human keratin K4 coupled to KLH as the immunogen.

FSCN3 antibody was raised in Rabbit using Human FSCN3 as the immunogen

Rabbit anti-bovine IgG (H+L) was raised in rabbit using bovine IgG whole molecule as the immunogen.

Affinity purified Rabbit polyclonal UBE2B antibody

Goat anti-mouse IgG/IgM (H+L) (Alk Phos) was raised in goat using murine IgG and IgM whole molecules as the immunogen.

CD117 antibody (PE) was raised in mouse using human MO7e tumor cells as the immunogen.

Affinity purified Rabbit polyclonal GULP1 antibody

GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE

Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.

NANP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

CD79b antibody (biotin) was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.

Goat anti-rat IgM (FITC) was raised in goat using rat IgM mu chain as the immunogen.

ZNF419A antibody was raised in rabbit using the C terminal of ZNF419A as the immunogen

Rabbit polyclonal NR2C1 antibody

The MDMA antibody is a monoclonal antibody that is used in Life Sciences research. It has the ability to specifically bind to MDMA (3,4-methylenedioxymethamphetamine), commonly known as ecstasy. This antibody can be used for various applications, such as detecting MDMA in biological samples or studying its effects on different systems.

ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen

Rabbit polyclonal Coflin 1 and Cofilin 2 antibody

EI24 antibody was raised in Rabbit using Human EI24 as the immunogen

PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen

IFN gamma antibody is a highly specific antibody that targets interferon gamma, a key cytokine involved in immune response regulation. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and ELISA. It specifically recognizes the carbonyl group of IFN gamma and has been extensively validated for its high affinity and specificity. It can effectively neutralize the activity of IFN gamma in vitro and in vivo, making it a valuable tool for studying the role of this cytokine in various biological processes. Whether you are investigating immune responses, studying growth factors, or exploring the effects of IFN gamma on different cell types, this antibody is an excellent choice for your research needs. Trust its reliable performance to provide accurate and reproducible results every time.

IgM antibody was raised in Mouse using recombinant human IgM as the immunogen.

Purified Rabbit polyclonal USP35 antibody

The MKK6 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It specifically targets the activated form of MKK6, a key enzyme involved in the natriuretic signaling pathway. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting MKK6 activation in various experimental settings.

Goat anti-human IgG (H+L) (FITC) was raised in goat using human IgG whole molecule as the immunogen.

Cytokeratin 20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

Factor IX antibody is a highly specialized polyclonal antibody that targets and neutralizes the activity of Factor IX, a crucial protein involved in blood clotting. This antibody is widely used in Life Sciences research and diagnostic applications. It has been extensively studied for its potential therapeutic use as an anti-her2 antibody, monoclonal antibody, and family kinase inhibitor. Factor IX antibody has also been shown to have an inhibitory effect on interferon, chemokine, and epidermal growth factor signaling pathways. Its high specificity and affinity make it an ideal tool for various immunoassays, including enzyme-linked immunosorbent assays (ELISA) and Western blotting. Additionally, this antibody can be conjugated with different molecules or labeled with spectrometric tags for advanced detection methods. With its lysine-specific binding properties, Factor IX antibody offers researchers a valuable resource for studying blood coagulation disorders and developing targeted therapies.

CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.