Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
IL11R alpha antibody
IL11R alpha antibody was raised using the middle region of IL11RA corresponding to a region with amino acids FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA
Purity:Min. 95%ApoJ antibody
ApoJ antibody was raised in goat using human apolipoprotein type J as the immunogen.Purity:Min. 95%SGK3 antibody
SGK3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%PRDM13 antibody
PRDM13 antibody was raised in rabbit using the N terminal of PRDM13 as the immunogen
Purity:Min. 95%Goat anti Mouse IgG + IgM (rhodamine)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purity:Min. 95%CD19 antibody (Allophycocyanin)
CD19 antibody (Allophycocyanin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.
Purity:Min. 95%ANKRA2 antibody
ANKRA2 antibody was raised in rabbit using the C terminal of ANKRA2 as the immunogen
Purity:Min. 95%vacA antibody
The vacA antibody is a glycoprotein that plays a crucial role in various biological processes. It exhibits phosphatase and tyrosinase activity, which are essential for cellular functions. This cytotoxic antibody binds to specific proteins and antigens, enabling targeted interactions in the body. In human serum, the vacA antibody has been shown to modulate melanogenesis, the process of pigment production in the skin. Its glycopeptide structure allows for effective antigen-antibody reactions, making it an ideal tool for research and diagnostic purposes. Whether you need a monoclonal or polyclonal antibody, our high-quality vacA antibodies are produced using state-of-the-art hybridoma cell technology. Trust our expertise in Life Sciences to provide you with reliable and accurate results for your scientific endeavors.Purity:Min. 95%Goat anti Rat IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.
Purity:Min. 95%Bin1 antibody
Bin1 antibody was raised in rabbit using the N terminal of Bin1 as the immunogen
Purity:Min. 95%Streptococcus Group A antibody (biotin)
Streptococcus group A antibody (biotin) was raised in rabbit using group A Streptococci as the immunogen.
Purity:Min. 95%Klotho Beta antibody
Klotho Beta antibody was raised using the middle region of KLB corresponding to a region with amino acids DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG
Purity:Min. 95%CD8a antibody (CY5)
CD8a antibody (CY5) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.
Purity:Min. 95%Cystatin C antibody
The Cystatin C antibody is a highly specialized antibody that is used in various applications in the field of Life Sciences. This polyclonal antibody specifically targets cystatin C, an anticoagulant protein that plays a crucial role in regulating protease activity. The Cystatin C antibody is widely used in research and diagnostic laboratories for the detection and quantification of cystatin C levels in biological samples.
Purity:Min. 95%Scg2 antibody
Scg2 antibody was raised in rabbit using the middle region of Scg2 as the immunogen
Purity:Min. 95%SET antibody
SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Purity:Min. 95%EVX1 antibody
EVX1 antibody was raised in rabbit using the N terminal of EVX1 as the immunogen
Purity:Min. 95%ZNF286 antibody
ZNF286 antibody was raised in rabbit using the C terminal of ZNF286 as the immunogenPurity:Min. 95%CD3e antibody (FITC)
CD3e antibody (FITC) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.
Purity:Min. 95%Goat anti Human IgG (HRP)
This antibody reacts with heavy chains on human IgG (gamma chain).Purity:Min. 95%USP33 antibody
USP33 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Parathyroid Hormone antibody
The Parathyroid Hormone antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Parathyroid Hormone, allowing for precise detection and analysis. It has been extensively used in research studies to investigate the role of Parathyroid Hormone in various biological processes.
TNF alpha antibody
TNF alpha antibody was raised in goat using highly pure recombinant human TNF-alpha as the immunogen.HNE antibody
HNE antibody was raised in goat using 4-Hydroxynonenal protein as the immunogen.Purity:Min. 95%TMEM195 antibody
TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL
Purity:Min. 95%DPY19L4 antibody
DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR
Purity:Min. 95%CD72.1 antibody (biotin)
CD72.1 antibody (biotin) was raised in mouse using DBA/2 murine spleen cells as the immunogen.
Purity:Min. 95%TGF beta 2 antibody
TGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT
Purity:Min. 95%SLC36A2 antibody
SLC36A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL
Purity:Min. 95%PARD6A antibody
PARD6A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
Goat anti Human Lambda Chain (Texas Red)
Goat anti-human lambda chain was raised in goat using human lambda light chain as the immunogen.
Purity:Min. 95%SLC27A2 antibody
SLC27A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Purity:Min. 95%GGT2 antibody
GGT2 antibody was raised in rabbit using the N terminal of GGT2 as the immunogen
Purity:Min. 95%anti-Goat IgG h+l Antibody (BIOTIN)
Biotin Conjugated Rabbit anti-Goat IgG h+l antibody.
Purity:Min. 95%CD3e antibody (biotin)
CD3e antibody (biotin) was raised in mouse using porcine CD3e as the immunogen.
Purity:Min. 95%
