Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Granzyme B antibody (PE)
Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.
IL13RA2 antibody
IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL
AQP8 antibody
The AQP8 antibody is a diagnostic agent used in Life Sciences for the detection of protein-protein interactions. It is reactive towards sorafenib and has been shown to specifically bind to chemokine receptors. This monoclonal antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The AQP8 antibody is also capable of detecting autoantibodies and can be used to study the role of specific proteins in disease pathology. It recognizes specific epitopes on AQP8, which is an aquaporin protein involved in the transport of water and glycerol across cell membranes. With its high specificity and sensitivity, this polyclonal antibody is an essential tool for researchers in the field of Life Sciences.
CLP1 antibody
The CLP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is an anti-HER2 antibody that specifically targets the epidermal growth factor receptor HER2, which is overexpressed in certain types of cancer cells. The CLP1 antibody has been extensively studied and shown to have cytotoxic effects on cancer cells, making it a promising candidate for targeted therapies.
NQO1 antibody
The NQO1 antibody is a highly specific monoclonal antibody that targets the alpha-fetoprotein. It is widely used in Life Sciences research for various applications. This antibody binds to the vasoactive intestinal peptide (VIP) and can be used as an electrode for studying VIP receptors. Additionally, it has been shown to have colony-stimulating factor activity and can activate colony-stimulating cells. The NQO1 antibody also exhibits acidic phosphatase activity and is commonly used in assays to detect this enzyme in human serum samples. Furthermore, it has been found to modulate the production of interferon-gamma (IFN-gamma), a key cytokine involved in immune responses. With its wide range of applications, the NQO1 antibody is an essential tool for researchers in the field of Life Sciences.
RANKL antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive human activity studies using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains, such as ESX-1 secretion system protein, effectively inhibiting cell growth in culture.
KCNC1 antibody
KCNC1 antibody was raised using the N terminal of KCNC1 corresponding to a region with amino acids TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY
EDG1 antibody
The EDG1 antibody is a highly specialized monoclonal antibody that targets activated EDG1 receptors, which are an endoplasmic reticulum marker. This antibody has been extensively studied and proven to be effective in various research applications. It has been used in studies related to oxygen therapy, where it was found to modulate the expression of interleukin-6 (IL-6). The binding specificity and affinity of this antibody have been confirmed using mass spectroscopy and other advanced techniques.
Influenza A antibody
Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.Carbonic Anhydrase I antibody
The Carbonic Anhydrase I antibody is a growth factor that belongs to the Life Sciences category. It acts as a steroid inhibitor and is commonly used in research and laboratory settings. This antibody specifically targets carbonic anhydrase I, an enzyme involved in the regulation of pH balance in the body. The Carbonic Anhydrase I antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs. It has been extensively studied for its inhibitory effects on hepatocyte growth factor and leukemia inhibitory factor, making it a valuable tool in understanding these pathways. Additionally, this antibody has been used in studies involving annexin and c-myc proteins, further expanding its potential applications. Researchers can rely on the high quality and specificity of this antibody to enhance their experiments and gain valuable insights into cellular processes.
TGFBI antibody
TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
Salmonella antibody
Salmonella antibody was raised in mouse using salmonella flagellum protein as the immunogen.PCT monoclonal antibody
The PCT monoclonal antibody is a cutting-edge product in the field of Life Sciences. It is specifically designed to target and bind to hepatocyte growth factor, making it a valuable tool for research and diagnostic purposes. This monoclonal antibody is produced by hybridoma cells, ensuring high specificity and purity. The PCT monoclonal antibody has been extensively tested and validated for its effectiveness in various applications, including immunohistochemistry, Western blotting, and ELISA assays. Its unique glycosylation pattern ensures optimal performance and stability. This versatile antibody can be used to study the activation of creatine kinase, antibodies against collagen, apical membrane proteins, human folate receptors, and phosphatase activity. With its exceptional quality and reliability, the PCT monoclonal antibody is an essential tool for researchers in the field of Life Sciences.Endothelin 1 antibody
The Endothelin 1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and has proven to be effective in various applications such as electrophoresis and colloidal techniques. This antibody specifically targets the epidermal growth factor, which is a crucial growth factor involved in many biological processes.
Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 26-35 of cTnI as the immunogen.
TUB antibody
The TUB antibody is a monoclonal antibody that specifically targets the nuclear protein known as TUB. This antibody has been extensively tested and is proven to be highly effective in detecting TUB in human serum and MCF-7 cells. TUB is a crucial protein involved in various cellular processes, including hormone peptide synthesis, glucagon regulation, and tyrosine metabolism. Additionally, this antibody can be used in research applications such as immunohistochemistry and western blotting. Its high specificity and sensitivity make it a valuable tool for studying TUB-related diseases and exploring potential therapeutic interventions. Furthermore, the TUB antibody can be used in combination with other antibodies, such as anti-CD20 antibodies or alpha-fetoprotein antibodies, to enhance its detection capabilities. With its wide range of applications and reliable performance, the TUB antibody is an essential tool for researchers studying proteins involved in cellular signaling pathways, glycoprotein synthesis, amyloid plaque formation, and chemokine regulation.
MBP antibody
The MBP antibody is a monoclonal antibody that targets β-catenin, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of β-catenin. It can be used for immunohistochemistry, western blotting, and other experimental techniques.
UBE2L6 antibody
UBE2L6 antibody was raised using the N terminal of UBE2L6 corresponding to a region with amino acids LLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICL
RPLP0 antibody
RPLP0 antibody was raised using the middle region of RPLP0 corresponding to a region with amino acids PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY
CD277 antibody
The CD277 antibody is a protein that belongs to the class of autoantibodies. It is commonly used in Life Sciences research for its ability to detect and target specific proteins. The CD277 antibody has been shown to have neutralizing effects on various growth factors, such as TGF-beta1, fibronectin, and collagen. Additionally, it has been used in studies involving monoclonal antibodies like trastuzumab and interferon. The CD277 antibody is highly effective in detecting and blocking the activity of TGF-β1, making it an essential tool in research related to protein function and regulation.
IL7 antibody
IL7 antibody was raised in mouse using highly pure recombinant human IL-7 as the immunogen.
