Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Annexin A5 antibody
Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
EEF1A2 antibody
EEF1A2 antibody was raised using the middle region of EEF1A2 corresponding to a region with amino acids VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP
TMEM24 antibody
TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL
Purity:Min. 95%Influenza A antibody
The Influenza A antibody is a highly effective monoclonal antibody that targets the growth factor of the influenza virus. This antibody specifically binds to extracellular proteins of the virus, preventing its attachment and entry into host cells. By neutralizing the virus, it helps to inhibit viral replication and spread within the body.
Purity:≥95% By Sds-PageGoat anti Human IgG (HRP)
Goat anti-human IgG (HRP) was raised in goat using human IgG gamma chain as the immunogen.Purity:Min. 95%Mouse anti Goat IgG (H + L) (HRP)
Mouse anti-goat IgG (H + L) (HRP) was raised in mouse using goat IgG (H & L) as the immunogen.Purity:Min. 95%CD49d antibody (PE)
CD49d antibody (PE) was raised in mouse using human CD49d as the immunogen.
Purity:Min. 95%PRSS16 antibody
PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
Purity:Min. 95%PNOC antibody
PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY
Purity:Min. 95%CKMB Antibody
The CKMB Antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is specifically designed to target and bind to the CKMB protein, which is an important biomarker for various cardiac conditions.TGF beta 1 antibody
TGF beta 1 antibody was raised in mouse using highly pure recombinant human TGF-beta1 as the immunogen.
Rabbit anti Goat IgG (H + L) (Alk Phos)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Purity:Min. 95%Mouse Thymocyte antibody
Mouse thymocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.Purity:Min. 95%SLAMF7 antibody
The SLAMF7 antibody is a highly specialized biomolecule that acts as a growth factor and protein kinase. It is commonly used in Life Sciences research and has proven to be an invaluable tool for scientists in various fields. This monoclonal antibody specifically targets the interleukin-15 receptor, which plays a crucial role in immune response regulation.
MST4 antibody
The MST4 antibody is a chimeric protein that falls under the category of Life Sciences. It is a monoclonal antibody that specifically targets MST4, a protein involved in various cellular processes. This antibody has been extensively studied and characterized for its high specificity and affinity towards MST4.
IFN gamma antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.
IRX6 antibody
IRX6 antibody was raised in rabbit using the C terminal of IRX6 as the immunogen
Purity:Min. 95%MtSSB antibody
The MtSSB antibody is a diagnostic biomarker that plays a crucial role in various biological processes. It is a proline-rich protein that has been extensively studied for its potential applications in medicine. The emission of caveolin-1 and palmitate have been shown to be influenced by the presence of MtSSB antibodies. These antibodies have the ability to inhibit interferon signaling, making them valuable tools for research and diagnostics in the field of Life Sciences. As polyclonal antibodies, they can serve as a reliable detection reagent for identifying and quantifying MtSSB in samples. Additionally, their inhibitory properties make them an attractive target for developing therapeutic strategies against diseases involving reductase activity.
PHEX antibody
The PHEX antibody is a highly specialized polyclonal antibody that targets the hormone peptide interleukin-6 (IL-6). It is produced using a hybridoma cell line, which ensures high specificity and potency. This antibody acts as an inhibitory factor, neutralizing the effects of IL-6 and preventing its interaction with receptors.
BRCA1 antibody
The BRCA1 antibody is a growth factor that has been extensively studied in the field of Life Sciences. It has shown promising results in various experiments, including phorbol-induced differentiation and interferon-mediated signaling pathways. This monoclonal antibody has been used for neutralizing experiments, electrophoresis, and as an electrode in various research studies. The BRCA1 antibody is produced using a state-of-the-art lyophilization method to ensure its stability and efficacy. It is also available as an anticoagulant for specific applications. This antibody is highly specific and can be used to detect autoantibodies or as a tool for studying the expression of BRCA1 protein in different tissues.
TSHR antibody
TSHR antibody is a monoclonal antibody that acts as an inhibitor of the epidermal growth factor family kinase. It specifically targets and binds to the thyroid-stimulating hormone receptor (TSHR) in the nucleus, preventing its activation by autoantibodies. This antibody has been shown to exhibit cytotoxic effects on cells expressing TSHR, inhibiting their growth and proliferation. Additionally, it has been found to modulate the activity of transforming growth factor-beta 1 (TGF-β1), a potent growth factor involved in various cellular processes. TSHR antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its use has also been associated with reduced superoxide production and protection against thrombocytopenia. With its ability to target TSHR and influence key signaling pathways, this antibody holds great potential for research in the fields of thyroid biology, autoimmune diseases, and cancer therapy.
CCL2 antibody
The CCL2 antibody is a monoclonal antibody that targets the chemokine CCL2, also known as monocyte chemoattractant protein-1 (MCP-1). It is used in Life Sciences research to study the role of CCL2 in various physiological and pathological processes. This antibody specifically binds to CCL2 and can be used for applications such as immunohistochemistry, flow cytometry, and ELISA. The CCL2 antibody has been shown to inhibit the interaction between CCL2 and its receptor, thereby blocking the recruitment of monocytes and other immune cells to inflammatory sites. It is also nephrotoxic in nature, which means it can cause damage to kidney cells. Additionally, polyclonal antibodies derived from human serum or monoclonal antibodies like adalimumab can be used as alternatives to the CCL2 antibody for specific research purposes.
Glyoxalase I antibody
The Glyoxalase I antibody is a neuroprotective glycosylation inhibitor that targets glycopeptides such as transferrin, insulin, and fibronectin. It is widely used in Life Sciences research to study the role of glycosylation in various biological processes. This polyclonal antibody specifically binds to acidic collagens and has been shown to be effective in detecting antiphospholipid antibodies and autoantibodies. Additionally, it can be used as an insulin antibody for studying insulin signaling pathways. The Glyoxalase I antibody is a valuable tool for researchers investigating glycosylation-related mechanisms and can serve as an anticoagulant in certain applications. With its high specificity and sensitivity, this antibody is an essential component of any laboratory working with Polyclonal Antibodies.
