Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75512 products of "Primary Antibodies"
PGAM1 antibody
The PGAM1 antibody is a highly versatile and potent tool used in various industries, including Life Sciences and industrial applications. This antibody exhibits antioxidant activity and has been shown to have an inhibitory effect on the growth factor. It can be immobilized for use in various assays, making it an essential component in molecular biology research.
p63 antibody
The p63 antibody is a monoclonal antibody that specifically targets the p63 protein. It has been shown to have inhibitory properties against diacylglycerol and interferon, making it a potential therapeutic agent for various diseases. The p63 antibody is also known to inhibit the activity of histidine kinases, which are involved in cell signaling pathways. Additionally, this antibody has cytotoxic effects on cancer cells and can be used as a family kinase inhibitor. It has been shown to interact with β-catenin, a key protein involved in cell adhesion and signaling. The p63 antibody is widely used in Life Sciences research and can be utilized in studies related to epidermal growth factor and glycoprotein signaling pathways. Its unique properties make it a valuable tool for understanding cellular processes and developing new treatments in the field of molecular biology.
KCTD11 antibody
KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids RLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALL
BAG2 antibody
BAG2 antibody was raised using the C terminal of BAG2 corresponding to a region with amino acids VDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSK
MAOA antibody
The MAOA antibody is a highly specific and potent inhibitor of the enzyme monoamine oxidase A (MAOA). This antibody binds to the active site of MAOA, preventing its enzymatic activity. MAOA plays a crucial role in the metabolism of histamine, serotonin, and other neurotransmitters, making it an important target for therapeutic interventions. The MAOA antibody has been extensively studied in various research areas, including neuroscience, oncology, and immunology.
Benzodiazepine antibody
Benzodiazepine antibody was raised in mouse using benzodiazepine as the immunogen.
SATB1 antibody
The SATB1 antibody is a highly specialized growth factor that belongs to the class of antibodies. It is a monoclonal antibody that has cytotoxic and antiangiogenic properties, making it an effective proliferation inhibitor. In the field of Life Sciences, this antibody is widely used for its ability to neutralize various growth factors, including epidermal growth factor (EGF), transforming growth factor-beta (TGF-beta), and chemokines. The SATB1 antibody specifically targets low-molecular-weight endothelial growth factors, inhibiting their activity and preventing angiogenesis. This monoclonal antibody is a valuable tool in research and clinical applications related to cancer, inflammation, and other diseases involving abnormal cell growth.
ERBB3 antibody
ERBB3 antibody was raised in Mouse using a purified recombinant fragment of ERBB3(aa1175-1275) expressed in E. coli as the immunogen.Donkey anti Rat IgG (H + L) (FITC)
Donkey anti-rat IgG (H + L) (FITC) was raised in donkey using Rat IgG (H&L) as the immunogen.
RAD23A antibody
RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNN
PTGFRN antibody
The PTGFRN antibody is a highly specialized polyclonal antibody that targets the PTGFRN protein. This protein is involved in various cellular processes, including signal transduction and gene expression regulation. The PTGFRN antibody specifically recognizes and binds to the p38 mitogen-activated protein (MAP) kinase and nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathways.
HDAC2 antibody
The HDAC2 antibody is a highly specific and potent cytotoxic agent that targets HDAC2, an enzyme involved in gene regulation. This antibody has been extensively studied in various research fields, including Life Sciences and drug development.
SAMSN1 antibody
SAMSN1 antibody was raised using the middle region of SAMSN1 corresponding to a region with amino acids DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS
PSR antibody
The PSR antibody is a highly specialized monoclonal antibody used in various assays and research studies in the field of Life Sciences. It is specifically designed to target alpha-synuclein (α-syn), a protein associated with neurodegenerative disorders such as Parkinson's disease.
Chlorpyrifos antibody
The Chlorpyrifos antibody is a growth factor that specifically targets messenger RNA (mRNA) molecules. It is a monoclonal antibody that is designed to detect and bind to contaminants, such as chlorpyrifos, in various samples. This antibody is widely used in the field of Life Sciences for applications such as immunoassays and polymerase chain reactions (PCR). The Chlorpyrifos antibody offers high specificity and sensitivity, making it an ideal choice for researchers and scientists working in environmental monitoring, agriculture, and toxicology. With its excellent chemical stability and long shelf life, this antibody ensures reliable results and consistent performance. Whether you need to detect chlorpyrifos residues or develop a medicament for exposure prevention, the Chlorpyrifos antibody is your go-to solution. Choose from our wide range of options, including gold nanoparticle-conjugated antibodies or polyclonal antibodies, to suit your specific research needs.
DPYS antibody
DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID
Factor IX antibody
Factor IX antibody was raised in sheep using human Factor IX purified from plasma as the immunogen.
PKC alpha antibody
The PKC alpha antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to protein kinase C alpha (PKC alpha), an enzyme involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.
NNMT antibody
The NNMT antibody is a highly effective medicament used in the field of Life Sciences. It is specifically designed to target and bind to the NNMT protein, enabling researchers to study its functions and interactions in various biological processes. This monoclonal antibody exhibits a strong antigen-antibody reaction, allowing for precise detection and analysis of NNMT in samples.
ATF2 antibody
The ATF2 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications. This antibody specifically targets ATF2, a transcription factor involved in various cellular processes such as DNA repair and apoptosis.
IFNAR1 antibody
The IFNAR1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and bind to the IFNAR1 protein, which plays a crucial role in the immune response. This antibody has been extensively tested and validated for its efficacy in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
gp340 antibody
The gp340 antibody is a highly specialized monoclonal antibody that is designed to target and neutralize specific proteins in the body. It has been extensively tested and proven effective in various research studies conducted by Life Sciences professionals. This antibody specifically targets influenza hemagglutinin, a protein that plays a crucial role in the growth and spread of the influenza virus.
Ibuprofen antibody
The Ibuprofen antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind specifically to Ibuprofen, a nonsteroidal anti-inflammatory drug commonly used for pain relief and reducing inflammation. This antibody can be used in various assays, including nuclear and GAPDH assays, to detect the presence and levels of Ibuprofen in samples.
Fibrinogen antibody
Fibrinogen antibody was raised in mouse using fibrin degradation products as the immunogen.
