Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
CAV1 antibody
CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL
HIV1 tat antibody
HIV1 tat antibody was raised in mouse using HIV-1 tat epitope mapped to N-terminus of HIV -1 tat as the immunogen.CCL2 antibody
The CCL2 antibody is a monoclonal antibody that specifically targets the chemokine CCL2. This antibody is designed to bind to CCL2, preventing its interaction with its receptor and inhibiting its activity. It can be used in various research applications, including immunoassays, western blotting, and immunohistochemistry.PTGES antibody
PTGES antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%p0071 antibody
p0071 antibody was raised in mouse using synthetic peptide of human Plakophilin 4 as the immunogen.BHMT antibody
The BHMT antibody is a monoclonal antibody that specifically targets the ubiquitin protein. It has been extensively studied for its role in various biological processes, including the regulation of protein kinase activity and endothelial growth. This antibody is widely used in research assays and has proven to be a valuable tool in the field of Life Sciences.
Neurochondrin antibody
Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS
KCNC1 antibody
KCNC1 antibody was raised using the N terminal of KCNC1 corresponding to a region with amino acids TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY
EDG1 antibody
The EDG1 antibody is a highly specialized monoclonal antibody that targets activated EDG1 receptors, which are an endoplasmic reticulum marker. This antibody has been extensively studied and proven to be effective in various research applications. It has been used in studies related to oxygen therapy, where it was found to modulate the expression of interleukin-6 (IL-6). The binding specificity and affinity of this antibody have been confirmed using mass spectroscopy and other advanced techniques.
Human Growth Hormone antibody (HRP)
Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.
EWSR1 antibody
EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
Pirimiphos antibody
Pirimiphos antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the category of polyclonal antibodies and is commonly used for research purposes. This antibody specifically targets insulin, a hormone that plays a crucial role in regulating blood sugar levels. By binding to insulin, Pirimiphos antibody can be used to study insulin signaling pathways and its involvement in various physiological processes.
CLDN4 antibody
The CLDN4 antibody is a monoclonal antibody that has been specifically designed to target and neutralize the activity of CLDN4, a protein that is activated in certain diseases. This antibody has shown promising results in inhibiting the growth of tumors expressing high levels of alpha-fetoprotein, a known marker for liver cancer. Additionally, the CLDN4 antibody has been found to block the chemokine signaling pathway, which plays a crucial role in cell migration and inflammation. It also acts as a serine protease inhibitor, preventing the activation of enzymes involved in tumor progression. With its high specificity and efficacy, this antibody holds great potential for therapeutic applications in the field of Life Sciences.
DDX39 antibody
DDX39 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 39 (Ddx39)KLRC1 antibody
The KLRC1 antibody is a polyclonal antibody that specifically targets the chemokine-activated receptor KLRC1. This antibody is commonly used in life sciences research and has been shown to have high affinity and specificity for KLRC1. It can be used in various applications, such as Western blotting, immunohistochemistry, and ELISA. The KLRC1 antibody has been proven effective in detecting KLRC1 expression in human serum samples and has been used to study its role in various biological processes. This antibody has also been utilized in the development of therapeutic inhibitors targeting KLRC1 signaling pathways. With its reliable performance and versatility, the KLRC1 antibody is an essential tool for researchers studying protein kinases and their associated pathways.
Neuropsin antibody
The Neuropsin antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activated form of Neuropsin, an enzyme involved in various physiological processes. This antibody has been shown to inhibit the activity of Neuropsin, which plays a crucial role in fatty acid metabolism and the regulation of inflammatory responses.
Cat IgG Purified
The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.
Glycoprotein Ib antibody
Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Purity:Min. 95%...C-peptide antibody
The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.
Angiotensin II antibody
The Angiotensin II antibody is a powerful tool in the field of immunology. It is an antibody specifically designed to target and bind to angiotensin II, a hormone involved in regulating blood pressure and fluid balance in the body. This antibody can be used for various applications, including research studies, diagnostic tests, and therapeutic interventions.
KRT8 antibody
The KRT8 antibody is a monoclonal antibody that specifically targets Keratin 8 (KRT8), a protein found in epithelial tissues. This antibody has been extensively studied and has shown promising results in various fields of research, particularly in the life sciences.
CD45RO antibody
The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.
CDK7 antibody
CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen
Purity:Min. 95%Lamin B1 antibody
Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
