Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CACNB4 antibody
CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
FAM13C1 antibody
FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD
EMR1 antibody
The EMR1 antibody is a polyclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and neutralize glutamate, an important neurotransmitter in the human body. This antibody has been shown to have high affinity and specificity for its target, making it an effective tool for researchers studying glutamate-related processes.
GMCSF antibody
The GMCSF antibody is a highly specialized protein used in the field of Life Sciences. It is commonly used in research and diagnostic applications. This antibody plays a crucial role in regulating the growth and development of various cells in the body, including white blood cells.
PUMA antibody
The PUMA antibody is a powerful tool in the field of Life Sciences. It is an autoantibody that specifically targets and neutralizes the activity of PUMA (p53 upregulated modulator of apoptosis) protein. PUMA plays a crucial role in regulating cell death and is involved in various physiological processes, including embryonic development, tissue homeostasis, and immune response.
CAD antibody
The CAD antibody is a monoclonal antibody that specifically targets fatty acid and protein biomarkers. It is commonly used in immunoassay tests to detect the presence of these biomarkers in various samples. The reactive nature of this antibody makes it a potential biomarker for research in the Life Sciences field.
Connexin 43 antibody
Connexin 43 antibody is a glycoprotein that plays a crucial role in cell communication. It is commonly used in life sciences research as a tool to study the function of connexin proteins. This polyclonal antibody specifically targets connexin 43, which is one of the most abundant connexin isoforms found in various tissues and organs.
DLST antibody
The DLST antibody is a highly specialized product that is essential for various research and laboratory applications in the field of Life Sciences. This antibody specifically binds to DLST, which stands for Dihydrolipoamide S-Succinyltransferase, an important enzyme involved in cellular metabolism.
SAP130 antibody
The SAP130 antibody is a highly specialized antibody that plays a crucial role in various biological processes. This antibody specifically targets the SAP130 protein, which is involved in the regulation of gene expression and chromatin remodeling. By binding to SAP130, this antibody can modulate the activity of calmodulin, an important calcium-binding protein.
AQP3 antibody
The AQP3 antibody is a spectrometric monoclonal antibody that is used in Life Sciences research. It specifically targets the aquaporin-3 (AQP3) protein, which plays a crucial role in water and glycerol transport across cell membranes. This antibody has been extensively studied and validated for its ability to detect AQP3 in various samples, including human serum.
Protein C antibody (HRP)
Protein C antibody (HRP) was raised in sheep using human Protein C purified from plasma as the immunogen.
CHST1 antibody
CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL
SIGLEC9 antibody
The SIGLEC9 antibody is a polyclonal antibody that specifically targets SIGLEC9, a glycoprotein that plays a crucial role in various biological processes. This antibody is produced using glycine and disulfide bond technology, resulting in high-quality antibodies with excellent specificity and sensitivity. It can be used in various applications in the field of life sciences, such as immunohistochemistry, flow cytometry, and Western blotting.
CUGBP2 antibody
CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP
CEA antibody
The CEA antibody is a monoclonal antibody that targets the carcinoembryonic antigen (CEA), a protein that is overexpressed in certain types of cancer cells. This antibody specifically binds to CEA and can be used for various applications in the field of Life Sciences. It has been widely used in research studies to detect CEA expression in tumor tissues and monitor its levels in patient samples.
MMP2 antibody
The MMP2 antibody is a highly specialized polyclonal antibody that targets the matrix metalloproteinase 2 (MMP2) protein. This antibody is widely used in life sciences research to study the role of MMP2 in various biological processes. MMP2 is a key enzyme involved in the degradation of extracellular matrix components, and its dysregulation has been implicated in several diseases, including cancer, cardiovascular diseases, and inflammatory disorders.
RAD51A antibody
The RAD51A antibody is a highly specialized polyclonal antibody that is commonly used in life sciences research. It is also available as a monoclonal antibody for more specific applications. This antibody plays a crucial role in DNA repair and recombination processes by binding to the RAD51 protein, which is involved in homologous recombination. The RAD51A antibody can be used in various techniques, such as immunofluorescence, immunohistochemistry, and western blotting, to study the expression and localization of RAD51A in different cell types and tissues. It is often conjugated with colloidal gold or fluorescent dyes like fluorescein isothiocyanate (FITC) for easy detection. The RAD51A antibody has high affinity and specificity for its target antigen, allowing for accurate quantitation and neutralizing activity against the RAD51 protein. Researchers rely on this antibody to gain insights into DNA repair mechanisms, cancer biology, and other areas of scientific interest.
MC5R antibody
The MC5R antibody is a highly specialized monoclonal antibody that binds to the MC5 receptor, a specific type of receptor found in various cells throughout the body. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
RPL9 antibody
RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
KLK7 antibody
The KLK7 antibody is a highly potent and specific monoclonal antibody that targets the KLK7 antigen. It has been widely used in Life Sciences research for its ability to detect and immobilize KLK7 in various applications. This antibody binds to KLK7 with high affinity, allowing for accurate and reliable detection of this protein. Additionally, the KLK7 antibody has been shown to have minimal cross-reactivity with other proteins, ensuring precise and specific results. It is commonly used in studies involving actin filaments, atypical hemolytic disorders, and nuclear localization of proteins. The KLK7 antibody is available in both purified and conjugated forms, making it versatile for a wide range of experimental needs. With its exceptional sensitivity and specificity, this antibody is an essential tool for researchers in the field of Life Sciences.
NR2F6 antibody
NR2F6 antibody was raised using the N terminal of NR2F6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
Annexin A3 antibody
The Annexin A3 antibody is an essential antibody-drug that plays a crucial role in various biological processes. It specifically targets and binds to Annexin A3, a protein involved in glucagon receptor binding and antigen presentation. This antibody is available in both polyclonal and monoclonal forms, offering versatility for different research applications.
Donkey anti Sheep IgG (H + L) (FITC)
Donkey anti-sheep IgG (H + L) (FITC) was raised in donkey using sheep IgG (H&L) as the immunogen.
WDR23 antibody
WDR23 antibody was raised using the N terminal of WDR23 corresponding to a region with amino acids GSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLR
Cyclin D1 antibody
The Cyclin D1 antibody is a globulin-based neutralizing antibody that specifically targets Cyclin D1, a protein involved in cell cycle regulation. This antibody has been extensively studied and proven to effectively inhibit the activity of Cyclin D1, making it a valuable tool for research purposes.
UCHL5IP antibody
UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC
