Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
PNPase antibody
The PNPase antibody is a valuable tool in Life Sciences research. It is a polyclonal antibody that specifically targets the alpha-synuclein protein. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.
UBE2J2 antibody
UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK
Cytokeratin 19 antibody
The Cytokeratin 19 antibody is a highly effective polyclonal antibody that targets and binds to Cytokeratin 19, a protein that plays a crucial role in cell adhesion and differentiation. This antibody has been extensively tested and proven to be reliable in detecting the presence of Cytokeratin 19 in various biological samples.
DDX3Y antibody
The DDX3Y antibody is a polyclonal antibody that has minimal toxicity and is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including colony-stimulating factor production, chemokine signaling, and immune response modulation. This antibody can be used for cytometry analysis to detect the presence of DDX3Y protein in cells or tissues.
ARHGAP25 antibody
ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL
WNT10B antibody
WNT10B antibody was raised in Mouse using a purified recombinant fragment of human WNT10B expressed in E. coli as the immunogen.
FOSB antibody
The FOSB antibody is a highly specialized product in the field of Life Sciences. It is designed to target actin filaments that have been activated in various biological systems. This antibody has been extensively tested and proven to be effective in detecting the presence of actin filaments in human serum samples. Additionally, it has shown strong affinity for nuclear actin and has been used successfully in studies involving endothelial growth factors.
SLC25A22 antibody
SLC25A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS
PCAF antibody
The PCAF antibody is a monoclonal antibody that specifically targets the amino-terminal region of the PCAF protein. This antibody has been extensively studied and has shown promising results in various applications. It has been found to have neutralizing activity against TNF-α, a key cytokine involved in inflammatory processes. Additionally, the PCAF antibody has been shown to inhibit the formation of dimers of chemokine receptors, which are important for cell migration and activation.
RGS4 antibody
The RGS4 antibody is a polyclonal antibody that targets the growth factor receptor. It specifically binds to the activated form of epidermal growth factor (EGF) and inhibits its signaling pathway. This antibody has been widely used in life sciences research to study the role of EGF in various cellular processes, including cell proliferation, migration, and differentiation. Additionally, the RGS4 antibody has shown cytotoxic effects on cancer cells expressing high levels of c-myc and HER2/neu receptors. It can be used in combination with other antibodies such as trastuzumab to enhance their efficacy. The high viscosity of this antibody solution allows for easy handling and ensures consistent results. Overall, the RGS4 antibody is a valuable tool for researchers studying growth factor signaling pathways and their role in disease progression.
Peptide YY antibody
Peptide YY antibody is a calcitonin-like peptide that plays a role in regulating pancreatic insulin secretion. It is an activated and stable analogue of the peptide YY hormone. This antibody has been used in various studies in Life Sciences to investigate its effects on cholinergic and thyrotropin-releasing hormone-induced insulin secretion. Peptide YY antibody has also been utilized in research involving microinjection and subthreshold dose experiments, as well as the use of antisense oligodeoxynucleotides. This polyclonal antibody binds specifically to peptide YY, allowing for the detection and analysis of this hormone in different experimental settings.
CHUK antibody
CHUK antibody was raised in Mouse using a purified recombinant fragment of human CHUK expressed in E. coli as the immunogen.
Ubiquitin antibody
The Ubiquitin antibody is a highly specific monoclonal antibody that targets the ubiquitin molecule. It is widely used in life sciences research for various applications, including immunoassays and the detection of target molecules. This antibody has been shown to have a high affinity for ubiquitin and can effectively detect its presence in samples.Streptomycin antibody
Streptomycin antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Antibodies and is colloidal in nature. This antibody specifically targets IL-17A, a cytokine involved in various inflammatory processes. It can be used in flow immunoassays to detect and quantify IL-17A levels in biological samples.Purity:Min. 95%CDK7 antibody
CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen
Purity:Min. 95%CYP1A2 antibody
The CYP1A2 antibody is a highly specific antibody that is used in various research and diagnostic applications. It is a polyclonal antibody that has been developed to target the CYP1A2 protein, which is an enzyme involved in drug metabolism in the liver. This antibody has been extensively tested and validated for its specificity and sensitivity.
anti-Canine Parvovirus Antibody
Canine parvovirus (CPV) is a highly contagious viral infection that affects dogs, especially puppies and young dogs. The virus belongs to the Parvoviridae family and is closely related to feline panleukopenia virus (FPV), which affects cats.;This Monoclonal anti-Canine Parvovirus antibody is suitable for ELISA and LFD applications. Suggest using as capture antibody in LFD format.Purity:Min. 95%DUSP22 antibody
The DUSP22 antibody is a powerful tool used in the field of Life Sciences. It belongs to the class of interferon antibodies that specifically target and bind to DUSP22, a protein involved in various cellular processes. This antibody is designed to recognize specific polypeptide sequences found in DUSP22 and can be used for research purposes such as studying its expression levels or investigating its role in different biological pathways.
AFP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication in bacteria. Its effectiveness has been demonstrated through patch-clamp techniques on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.Keratin hHa5 antibody
Keratin hHa5 antibody was raised in guinea pig using a synthetic peptide of human hair (trichocytic) keratin hHa5 coupled to KLH as the immunogen.
Purity:Min. 95%WDR1 antibody
WDR1 antibody was raised using the C terminal of WDR1 corresponding to a region with amino acids LAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDE
CD8B antibody
CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI
Purity:Min. 95%TFPI antibody
TFPI antibody was raised in sheep using Synthetic peptide corresponding to NH-terminus of human TFPI conjugated to carrier as the immunogen.
Purity:Min. 95%CD62E antibody
The CD62E antibody is a glycan-specific monoclonal antibody that is widely used in the field of life sciences. This antibody specifically recognizes and binds to glycosylation sites on proteins, glycoproteins, and glycopeptides. It has been extensively studied for its potential applications in various research areas, including immunology, cell biology, and biochemistry.RPESP antibody
RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
FTSJ1 antibody
FTSJ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA
Factor I antibody
Factor I antibody was raised in goat using highly purified human complement protein as the immunogen.PYK2 antibody
The PYK2 antibody is a high-quality product in the field of Life Sciences. It belongs to the category of Antibodies and is colloidal in nature. This antibody is specifically designed to target and detect PYK2, a protein kinase that plays a crucial role in cell signaling pathways.
CYP1A2 antibody
The CYP1A2 antibody is a growth factor that plays a crucial role in various biological processes. It acts as an electrode, facilitating the transfer of electrons to proteins and fatty acids. This activated molecule drug also exhibits anticoagulant properties and has been shown to possess anti-VEGF (vascular endothelial growth factor) activity. Additionally, it interacts with insulin, albumin, and fibrinogen, making it a versatile therapeutic agent. The CYP1A2 antibody is a monoclonal antibody that targets endogenous hematopoietic cells and is commonly used in research and clinical settings. Its efficacy has been demonstrated in human serum, highlighting its potential for diagnostic applications.
