Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
BMP4 antibody
BMP4 antibody was raised in mouse using highly pure recombinant human BMP-4 as the immunogen.SH1 antibody
The SH1 antibody is a polyclonal antibody that has been developed as a potential biological tool for studying tumor biomarkers. It specifically targets the IL-17A antigen, which is known to be involved in various protein-protein interactions and signaling pathways. The SH1 antibody can be used in various life science applications, including immunohistochemistry, western blotting, and ELISA assays. It has been shown to exhibit strong inhibition effects on IL-17A activity in vitro and in vivo. The SH1 antibody is produced using a eukaryotic expression vector and synthetic techniques, ensuring high purity and specificity. With its unique characteristics and versatility, the SH1 antibody is an essential tool for researchers investigating IL-17A-related pathways and exploring potential therapeutic interventions.
SLC11A1 antibody
SLC11A1 antibody was raised using the C terminal of SLC11A1 corresponding to a region with amino acids VLLTRSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFT
Listeria antibody
The Listeria antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used in assays to detect the presence of Listeria monocytogenes, a bacterium that can cause serious infections in humans. This antibody specifically binds to nuclear antigens expressed by Listeria, allowing for easy detection and identification. The Listeria antibody is highly specific and sensitive, making it an essential tool for researchers studying this pathogen. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. With its high affinity and specificity, the Listeria antibody provides accurate and reliable results in detecting Listeria monocytogenes in samples such as human serum or colloidal suspensions. Researchers rely on this powerful tool to advance their understanding of Listeria infection and develop effective treatments.
SNAP25 antibody
The SNAP25 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used to detect and analyze the presence of SNAP25, a target molecule involved in various cellular processes. This antibody can be used in research applications such as immunohistochemistry, Western blotting, and flow cytometry.
CRELD1 antibody
CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
MCM5 antibody
The MCM5 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect the presence of MCM5 protein in human serum or other samples. This antibody can be immobilized on an electrode surface, allowing for the detection and quantification of MCM5 protein levels. The MCM5 antibody recognizes specific hormone peptides and fatty acids that are associated with the activation of MCM5. It can also be used as a tool to study the interaction between MCM5 and other molecules, such as tyrosine inhibitors or monoclonal antibodies. Molecular docking studies have shown that this antibody has a high affinity for activated MCM5, making it an effective tool for research purposes. Additionally, colloidal gold-labeled versions of this antibody can be used for immunohistochemical staining to visualize the expression of MCM5 in tissue samples.
CCL2 antibody
The CCL2 antibody is a monoclonal antibody that specifically targets the chemokine CCL2. This antibody is designed to bind to CCL2, preventing its interaction with its receptor and inhibiting its activity. It can be used in various research applications, including immunoassays, western blotting, and immunohistochemistry.ALDH1B1 antibody
ALDH1B1 antibody was raised using the middle region of ALDH1B1 corresponding to a region with amino acids GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL
CLCA1 antibody
The CLCA1 antibody is a neutralizing monoclonal antibody that is widely used in Life Sciences research. It specifically targets CLCA1, a protein involved in various biological processes including the regulation of epidermal growth factor and hepatocyte growth factor. This antibody has been shown to inhibit the activity of CLCA1 by binding to its target site, preventing its interaction with other proteins or growth factors. In addition, the CLCA1 antibody can be used for immobilization studies or as a tool for detecting CLCA1 dimers in experimental settings. Its high specificity and affinity make it an essential tool for researchers studying the role of CLCA1 in different cellular processes.
BDNF antibody
The BDNF antibody is a neuroprotective agent that acts as a family kinase inhibitor. It targets the adiponectin receptor, which is involved in various cellular processes related to adipose tissue. This antibody is commonly used in life sciences research and is available as both polyclonal and monoclonal antibodies.
CAV1 antibody
CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL
WDR8 antibody
WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML
TUB antibody
The TUB antibody is a monoclonal antibody that specifically targets the nuclear protein known as TUB. This antibody has been extensively tested and is proven to be highly effective in detecting TUB in human serum and MCF-7 cells. TUB is a crucial protein involved in various cellular processes, including hormone peptide synthesis, glucagon regulation, and tyrosine metabolism. Additionally, this antibody can be used in research applications such as immunohistochemistry and western blotting. Its high specificity and sensitivity make it a valuable tool for studying TUB-related diseases and exploring potential therapeutic interventions. Furthermore, the TUB antibody can be used in combination with other antibodies, such as anti-CD20 antibodies or alpha-fetoprotein antibodies, to enhance its detection capabilities. With its wide range of applications and reliable performance, the TUB antibody is an essential tool for researchers studying proteins involved in cellular signaling pathways, glycoprotein synthesis, amyloid plaque formation, and chemokine regulation.
Anti-HIV p24 antibody
The Anti-HIV p24 antibody is a powerful tool in the fight against HIV. This monoclonal antibody specifically targets the p24 protein, which is an essential component of the HIV virus. By binding to this protein, the antibody prevents the virus from replicating and spreading throughout the body. In addition to its antiviral properties, the Anti-HIV p24 antibody has been shown to have other beneficial effects. It has been found to inhibit epidermal growth factor signaling, which is involved in cell proliferation and survival. This can help prevent the spread of cancer cells and may have potential applications in cancer treatment. Furthermore, studies have shown that this antibody can enhance the effectiveness of other targeted therapies, such as trastuzumab for HER2-positive breast cancer. By combining these treatments, researchers have observed improved outcomes and increased patient survival rates. The Anti-HIV p24 antibody also has potential diagnostic applications. It can be used in laboratory tests to detect the presence of HIV infection by binding
CD8B antibody
CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI
Purity:Min. 95%PDE3A antibody
PDE3A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%DDOST antibody
DDOST antibody was raised using the N terminal of DDOST corresponding to a region with amino acids SPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFD
Luteinizing Hormone beta antibody
Luteinizing hormone beta antibody was raised in mouse using human LH as the immunogen.
Donkey anti Goat IgG (H + L) (biotin)
Donkey anti-goat IgG (H+L) (biotin) was raised in donkey using goat IgG whole molecule as the immunogen.Purity:Min. 95%KSHV K8 alpha antibody
KSHV K8 alpha antibody was raised in Mouse using a purified recombinant fragment of KSHV K8alpha expressed in E. coli as the immunogen.Rabbit anti Chicken IgG
Rabbit anti-chicken IgG was raised in rabbit using chicken IgG F(c) fragment as the immunogen.
Purity:Min. 95%CD24 antibody (PE)
CD24 antibody (PE) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%
